Recombinant Human FXYD1 protein, His-tagged
Cat.No. : | FXYD1-2996H |
Product Overview : | Recombinant Human FXYD1 protein(1-92 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-92 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FXYD1 FXYD domain containing ion transport regulator 1 [ Homo sapiens ] |
Official Symbol | FXYD1 |
Synonyms | FXYD1; FXYD domain containing ion transport regulator 1; phospholemman , PLM; phospholemman; PLM; MGC44983; |
Gene ID | 5348 |
mRNA Refseq | NM_005031 |
Protein Refseq | NP_005022 |
MIM | 602359 |
UniProt ID | O00168 |
◆ Recombinant Proteins | ||
FXYD1-13054H | Recombinant Human FXYD1, GST-tagged | +Inquiry |
RFL11242HF | Recombinant Full Length Human Phospholemman(Fxyd1) Protein, His-Tagged | +Inquiry |
FXYD1-2076R | Recombinant Rat FXYD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FXYD1-3400M | Recombinant Mouse FXYD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FXYD1-3011H | Recombinant Human FXYD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXYD1-6104HCL | Recombinant Human FXYD1 293 Cell Lysate | +Inquiry |
FXYD1-6105HCL | Recombinant Human FXYD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FXYD1 Products
Required fields are marked with *
My Review for All FXYD1 Products
Required fields are marked with *
0
Inquiry Basket