Recombinant Human FXYD1 protein, His-tagged
| Cat.No. : | FXYD1-2996H |
| Product Overview : | Recombinant Human FXYD1 protein(Ag25307), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Ag25307 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | FXYD1 FXYD domain containing ion transport regulator 1 [ Homo sapiens ] |
| Official Symbol | FXYD1 |
| Synonyms | FXYD1; FXYD domain containing ion transport regulator 1; phospholemman , PLM; phospholemman; PLM; MGC44983; |
| Gene ID | 5348 |
| mRNA Refseq | NM_005031 |
| Protein Refseq | NP_005022 |
| MIM | 602359 |
| UniProt ID | O00168 |
| ◆ Cell & Tissue Lysates | ||
| FXYD1-6105HCL | Recombinant Human FXYD1 293 Cell Lysate | +Inquiry |
| FXYD1-6104HCL | Recombinant Human FXYD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FXYD1 Products
Required fields are marked with *
My Review for All FXYD1 Products
Required fields are marked with *
