Recombinant Human FXYD7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FXYD7-3782H
Product Overview : FXYD7 MS Standard C13 and N15-labeled recombinant protein (NP_071289) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. This gene product, FXYD7, is novel and has not been characterized as a protein.
Molecular Mass : 8.5 kDa
AA Sequence : MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FXYD7 FXYD domain containing ion transport regulator 7 [ Homo sapiens (human) ]
Official Symbol FXYD7
Synonyms FXYD7; FXYD domain containing ion transport regulator 7; FXYD domain-containing ion transport regulator 7; FLJ25096;
Gene ID 53822
mRNA Refseq NM_022006
Protein Refseq NP_071289
MIM 606684
UniProt ID P58549

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FXYD7 Products

Required fields are marked with *

My Review for All FXYD7 Products

Required fields are marked with *

0
cart-icon