Recombinant Human FZD2 Protein, GST-tagged
Cat.No. : | FZD2-4591H |
Product Overview : | Human FZD2 partial ORF ( NP_001457, 192 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Members of the frizzled gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The expression of the FZD2 gene appears to be developmentally regulated, with high levels of expression in fetal kidney and lung and in adult colon and ovary. [provided by RefSeq |
Molecular Mass : | 31.68 kDa |
AA Sequence : | YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FZD2 frizzled family receptor 2 [ Homo sapiens ] |
Official Symbol | FZD2 |
Synonyms | FZD2; frizzled family receptor 2; frizzled (Drosophila) homolog 2, frizzled 2, seven transmembrane spanning receptor, frizzled homolog 2 (Drosophila); frizzled-2; frizzled homolog 2; frizzled 2, seven transmembrane spanning receptor; Fz2; fz-2; fzE2; hFz2; |
Gene ID | 2535 |
mRNA Refseq | NM_001466 |
Protein Refseq | NP_001457 |
MIM | 600667 |
UniProt ID | Q14332 |
◆ Recombinant Proteins | ||
FZD2-321H | Recombinant Human FZD2 protein, Fc-tagged | +Inquiry |
RFL2034MF | Recombinant Full Length Mouse Frizzled-2(Fzd2) Protein, His-Tagged | +Inquiry |
FZD2-2085R | Recombinant Rat FZD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FZD2-13065H | Recombinant Human FZD2, GST-tagged | +Inquiry |
Fzd2-53M | Recombinant Mouse Fzd2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FZD2 Products
Required fields are marked with *
My Review for All FZD2 Products
Required fields are marked with *
0
Inquiry Basket