Recombinant Human FZD2 Protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Human FZD2 Protein, GST-tagged

Recombinant Human FZD2 Protein, GST-tagged

FZD2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FZD2-4591H
Product Overview : Human FZD2 partial ORF ( NP_001457, 192 a.a. - 245 a.a.) recombinant protein with GST-tag at N-terminal.
Description : Members of the frizzled gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The expression of the FZD2 gene appears to be developmentally regulated, with high levels of expression in fetal kidney and lung and in adult colon and ovary. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 31.68 kDa
AA Sequence : YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : FZD2 frizzled family receptor 2 [ Homo sapiens ]
Official Symbol : FZD2
Synonyms : FZD2; frizzled family receptor 2; frizzled (Drosophila) homolog 2, frizzled 2, seven transmembrane spanning receptor, frizzled homolog 2 (Drosophila); frizzled-2; frizzled homolog 2; frizzled 2, seven transmembrane spanning receptor; Fz2; fz-2; fzE2; hFz2;
Gene ID : 2535
mRNA Refseq : NM_001466
Protein Refseq : NP_001457
MIM : 600667
UniProt ID : Q14332

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.