Recombinant Human FZD3 Protein, GST-tagged

Cat.No. : FZD3-6207H
Product Overview : Recombinant Human FZD3 protein (55 a.a. - 157 a.a.) was expressed in wheat germ with N-terminal GST-tag
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 55-157 a.a.
Description : This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.07 kDa
AA Sequence : QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV
Storage : store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name FZD3 frizzled family receptor 3 [ Homo sapiens ]
Official Symbol FZD3
Synonyms FZD3; frizzled family receptor 3; frizzled (Drosophila) homolog 3 , frizzled 3, seven transmembrane spanning receptor , frizzled homolog 3 (Drosophila); frizzled-3; frizzled homolog 3; frizzled 3, seven transmembrane spanning receptor; Fz-3
Gene ID 7976
mRNA Refseq NM_145866
Protein Refseq NP_665873
MIM 606143
UniProt ID Q9NPG1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FZD3 Products

Required fields are marked with *

My Review for All FZD3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon