Recombinant Human FZD6 Protein, GST-tagged
Cat.No. : | FZD6-4597H |
Product Overview : | Human FZD6 partial ORF ( NP_003497, 71 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene represents a member of the frizzled gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The protein encoded by this family member contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, and seven transmembrane domains, but unlike other family members, this protein does not contain a C-terminal PDZ domain-binding motif. This protein functions as a negative regulator of the canonical Wnt/beta-catenin signaling cascade, thereby inhibiting the processes that trigger oncogenic transformation, cell proliferation, and inhibition of apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq |
Molecular Mass : | 37.95 kDa |
AA Sequence : | PNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FZD6 frizzled family receptor 6 [ Homo sapiens ] |
Official Symbol | FZD6 |
Synonyms | FZD6; frizzled family receptor 6; frizzled (Drosophila) homolog 6, frizzled 6, seven transmembrane spanning receptor, frizzled homolog 6 (Drosophila); frizzled-6; Hfz6; frizzled homolog 6; seven transmembrane helix receptor; frizzled 6, seven transmembrane spanning receptor; FZ6; FZ-6; HFZ6; NDNC10; |
Gene ID | 8323 |
mRNA Refseq | NM_001164615 |
Protein Refseq | NP_001158087 |
MIM | 603409 |
UniProt ID | O60353 |
◆ Recombinant Proteins | ||
RFL10293PF | Recombinant Full Length Pongo Abelii Frizzled-6(Fzd6) Protein, His-Tagged | +Inquiry |
FZD6-4682C | Recombinant Chicken FZD6 | +Inquiry |
FZD6-739HB | Recombinant Human FZD6 Protein, His-Avi-tagged, biotinylated | +Inquiry |
RFL5021HF | Recombinant Full Length Human Frizzled-6(Fzd6) Protein, His-Tagged | +Inquiry |
FZD6-4597H | Recombinant Human FZD6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZD6-6089HCL | Recombinant Human FZD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FZD6 Products
Required fields are marked with *
My Review for All FZD6 Products
Required fields are marked with *
0
Inquiry Basket