Recombinant Human FZD6 Protein, GST-tagged

Cat.No. : FZD6-4597H
Product Overview : Human FZD6 partial ORF ( NP_003497, 71 a.a. - 181 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene represents a member of the frizzled gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The protein encoded by this family member contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, and seven transmembrane domains, but unlike other family members, this protein does not contain a C-terminal PDZ domain-binding motif. This protein functions as a negative regulator of the canonical Wnt/beta-catenin signaling cascade, thereby inhibiting the processes that trigger oncogenic transformation, cell proliferation, and inhibition of apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Molecular Mass : 37.95 kDa
AA Sequence : PNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FZD6 frizzled family receptor 6 [ Homo sapiens ]
Official Symbol FZD6
Synonyms FZD6; frizzled family receptor 6; frizzled (Drosophila) homolog 6, frizzled 6, seven transmembrane spanning receptor, frizzled homolog 6 (Drosophila); frizzled-6; Hfz6; frizzled homolog 6; seven transmembrane helix receptor; frizzled 6, seven transmembrane spanning receptor; FZ6; FZ-6; HFZ6; NDNC10;
Gene ID 8323
mRNA Refseq NM_001164615
Protein Refseq NP_001158087
MIM 603409
UniProt ID O60353

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FZD6 Products

Required fields are marked with *

My Review for All FZD6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon