Recombinant Human GAGE7 protein(1-117aa), His-tagged

Cat.No. : GAGE7-2924H
Product Overview : Recombinant Human GAGE7 protein(O76087)(1-117aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-117aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 20.6 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC
Gene Name GAGE7 G antigen 7 [ Homo sapiens ]
Official Symbol GAGE7
Synonyms G antigen 7; 4104; G antigen 12G;cancer/testis antigen 4.7;cancer/testis antigen family 4, member 7; AL4; CT4.7; GAGE-7
Gene ID 2579
mRNA Refseq NM_021123.2
Protein Refseq NP_066946.1
MIM 300601
UniProt ID O76087

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAGE7 Products

Required fields are marked with *

My Review for All GAGE7 Products

Required fields are marked with *

0
cart-icon