Recombinant Human GAGE7 protein(1-117aa), His-tagged
| Cat.No. : | GAGE7-2924H |
| Product Overview : | Recombinant Human GAGE7 protein(O76087)(1-117aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-117aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 20.6 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC |
| Gene Name | GAGE7 G antigen 7 [ Homo sapiens ] |
| Official Symbol | GAGE7 |
| Synonyms | G antigen 7; 4104; G antigen 12G;cancer/testis antigen 4.7;cancer/testis antigen family 4, member 7; AL4; CT4.7; GAGE-7 |
| Gene ID | 2579 |
| mRNA Refseq | NM_021123.2 |
| Protein Refseq | NP_066946.1 |
| MIM | 300601 |
| UniProt ID | O76087 |
| ◆ Recombinant Proteins | ||
| GAGE7-5215HF | Recombinant Full Length Human GAGE7 Protein, GST-tagged | +Inquiry |
| GAGE7-4668H | Recombinant Human GAGE7 Protein, GST-tagged | +Inquiry |
| GAGE7-13118H | Recombinant Human GAGE7, GST-tagged | +Inquiry |
| GAGE7-2924H | Recombinant Human GAGE7 protein(1-117aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GAGE7-6049HCL | Recombinant Human GAGE7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAGE7 Products
Required fields are marked with *
My Review for All GAGE7 Products
Required fields are marked with *
