Recombinant Human GAGE7 Protein, GST-tagged
Cat.No. : | GAGE7-4668H |
Product Overview : | Human GAGE7 full-length ORF (ABM85267.1, 1 a.a. - 117 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GAGE7 (G Antigen 7) is a Protein Coding gene. |
Molecular Mass : | 39.27 kDa |
AA Sequence : | MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GAGE7 G antigen 7 [ Homo sapiens ] |
Official Symbol | GAGE7 |
Synonyms | G antigen 7; 4104; G antigen 12G;cancer/testis antigen 4.7;cancer/testis antigen family 4, member 7; AL4; CT4.7; GAGE-7 |
Gene ID | 2579 |
mRNA Refseq | NM_021123 |
Protein Refseq | NP_066946 |
MIM | 300601 |
UniProt ID | O76087 |
◆ Recombinant Proteins | ||
GAGE7-2924H | Recombinant Human GAGE7 protein(1-117aa), His-tagged | +Inquiry |
GAGE7-4668H | Recombinant Human GAGE7 Protein, GST-tagged | +Inquiry |
GAGE7-13118H | Recombinant Human GAGE7, GST-tagged | +Inquiry |
GAGE7-5215HF | Recombinant Full Length Human GAGE7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAGE7-6049HCL | Recombinant Human GAGE7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAGE7 Products
Required fields are marked with *
My Review for All GAGE7 Products
Required fields are marked with *