Recombinant Human GAL Protein, GST-tagged

Cat.No. : GAL-4671H
Product Overview : Human GAL full-length ORF ( AAH30241, 1 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Galanin is small neuropeptide that functions as a cellular messenger within the central and peripheral nervous systems, modulating diverse physiologic functions (Mechenthaler, 2008 [PubMed 18500643]).[supplied by OMIM
Molecular Mass : 39.27 kDa
AA Sequence : MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GAL galanin prepropeptide [ Homo sapiens ]
Official Symbol GAL
Synonyms GAL; galanin prepropeptide; galanin, GALN; galanin peptides; galanin message associated peptide; GLNN; GMAP; galanin-related peptide; galanin-message-associated peptide; GALN; MGC40167;
Gene ID 51083
mRNA Refseq NM_015973
Protein Refseq NP_057057
MIM 137035
UniProt ID P22466

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAL Products

Required fields are marked with *

My Review for All GAL Products

Required fields are marked with *

0

Inquiry Basket

cartIcon