Recombinant Human GAL Protein, GST-tagged
Cat.No. : | GAL-4671H |
Product Overview : | Human GAL full-length ORF ( AAH30241, 1 a.a. - 123 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Galanin is small neuropeptide that functions as a cellular messenger within the central and peripheral nervous systems, modulating diverse physiologic functions (Mechenthaler, 2008 [PubMed 18500643]).[supplied by OMIM |
Molecular Mass : | 39.27 kDa |
AA Sequence : | MARGSALLLASLLLAAALSASAGLWSPAKEKRGWTLNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENNIMRTIIEFLSFLHLKEAGALDRLLDLPAAASSEDIERS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GAL galanin prepropeptide [ Homo sapiens ] |
Official Symbol | GAL |
Synonyms | GAL; galanin prepropeptide; galanin, GALN; galanin peptides; galanin message associated peptide; GLNN; GMAP; galanin-related peptide; galanin-message-associated peptide; GALN; MGC40167; |
Gene ID | 51083 |
mRNA Refseq | NM_015973 |
Protein Refseq | NP_057057 |
MIM | 137035 |
UniProt ID | P22466 |
◆ Recombinant Proteins | ||
GAL-5218HF | Recombinant Full Length Human GAL Protein, GST-tagged | +Inquiry |
GAL-3528H | Recombinant Human GAL Protein (Arg32-Arg122), N-His tagged | +Inquiry |
GAL-4671H | Recombinant Human GAL Protein, GST-tagged | +Inquiry |
GAL-289H | Recombinant Human GAL, Fc-tagged | +Inquiry |
GAL-539H | Recombinant Human galanin/GMAP prepropeptide, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GAL-759HCL | Recombinant Human GAL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GAL Products
Required fields are marked with *
My Review for All GAL Products
Required fields are marked with *
0
Inquiry Basket