Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GALNT1

Cat.No. : GALNT1-27302TH
Product Overview : Recombinant full length Human GALNT1, isoform 2 with N terminal proprietary tag. Predicted MW 37.62 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature.
Protein length : 105 amino acids
Molecular Weight : 37.620kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Widely expressed. Expressed in all tissues tested.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKER GLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFK INQFNLMASEMIALNRSLPDVRLEG
Sequence Similarities : Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.Contains 1 ricin B-type lectin domain.
Gene Name : GALNT1 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1) [ Homo sapiens ]
Official Symbol : GALNT1
Synonyms : GALNT1; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1); polypeptide N-acetylgalactosaminyltransferase 1; GalNAc T1; protein UDP acetylgalactosaminyltransferase 1;
Gene ID : 2589
mRNA Refseq : NM_020474
Protein Refseq : NP_065207
MIM : 602273
Uniprot ID : Q10472
Chromosome Location : 18q12.1
Pathway : Metabolic pathways, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; O-glycan biosynthesis, mucin type core, organism-specific biosystem; O-glycan biosynthesis, mucin type core, conserved biosystem;
Function : manganese ion binding; polypeptide N-acetylgalactosaminyltransferase activity; sugar binding; transferase activity, transferring glycosyl groups;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends