Recombinant Human GALNT1
Cat.No. : | GALNT1-27302TH |
Product Overview : | Recombinant full length Human GALNT1, isoform 2 with N terminal proprietary tag. Predicted MW 37.62 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature. |
Protein length : | 105 amino acids |
Molecular Weight : | 37.620kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Widely expressed. Expressed in all tissues tested. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKER GLPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFK INQFNLMASEMIALNRSLPDVRLEG |
Sequence Similarities : | Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.Contains 1 ricin B-type lectin domain. |
Gene Name : | GALNT1 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1) [ Homo sapiens ] |
Official Symbol : | GALNT1 |
Synonyms : | GALNT1; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1); polypeptide N-acetylgalactosaminyltransferase 1; GalNAc T1; protein UDP acetylgalactosaminyltransferase 1; |
Gene ID : | 2589 |
mRNA Refseq : | NM_020474 |
Protein Refseq : | NP_065207 |
MIM : | 602273 |
Uniprot ID : | Q10472 |
Chromosome Location : | 18q12.1 |
Pathway : | Metabolic pathways, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; O-glycan biosynthesis, mucin type core, organism-specific biosystem; O-glycan biosynthesis, mucin type core, conserved biosystem; |
Function : | manganese ion binding; polypeptide N-acetylgalactosaminyltransferase activity; sugar binding; transferase activity, transferring glycosyl groups; |
Products Types
◆ Recombinant Protein | ||
GALNT1-3448M | Recombinant Mouse GALNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GALNT1-1253H | Recombinant Human GALNT1 Protein, MYC/DDK-tagged | +Inquiry |
GALNT1-1626R | Recombinant Rhesus Macaque GALNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GALNT1-3004H | Recombinant Human GALNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GALNT1-2121R | Recombinant Rat GALNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
GALNT1-680HCL | Recombinant Human GALNT1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket