Recombinant Human GALNT1
| Cat.No. : | GALNT1-27304TH |
| Product Overview : | Recombinant fragment of Human GALNT1 with N terminal proprietary tag. Predicted MW 34.65 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 82 amino acids |
| Description : | This gene encodes a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. Transcript variants derived from this gene that utilize alternative polyA signals have been described in the literature. |
| Molecular Weight : | 34.650kDa inclusive of tags |
| Tissue specificity : | Widely expressed. Expressed in all tissues tested. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LPAGDVLEPVQKPHEGPGEMGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIV |
| Sequence Similarities : | Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.Contains 1 ricin B-type lectin domain. |
| Gene Name | GALNT1 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1) [ Homo sapiens ] |
| Official Symbol | GALNT1 |
| Synonyms | GALNT1; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GalNAc-T1); polypeptide N-acetylgalactosaminyltransferase 1; GalNAc T1; protein UDP acetylgalactosaminyltransferase 1; |
| Gene ID | 2589 |
| mRNA Refseq | NM_020474 |
| Protein Refseq | NP_065207 |
| MIM | 602273 |
| Uniprot ID | Q10472 |
| Chromosome Location | 18q12.1 |
| Pathway | Metabolic pathways, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; O-glycan biosynthesis, mucin type core, organism-specific biosystem; O-glycan biosynthesis, mucin type core, conserved biosystem; |
| Function | manganese ion binding; polypeptide N-acetylgalactosaminyltransferase activity; sugar binding; transferase activity, transferring glycosyl groups; |
| ◆ Recombinant Proteins | ||
| GALNT1-27302TH | Recombinant Human GALNT1 | +Inquiry |
| GALNT1-3004H | Recombinant Human GALNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GALNT1-5142HF | Recombinant Full Length Human GALNT1 Protein, GST-tagged | +Inquiry |
| GALNT1-676H | Active Recombinant Human GALNT1 Protein, His-tagged | +Inquiry |
| GALNT1-1523C | Recombinant Chicken GALNT1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GALNT1-680HCL | Recombinant Human GALNT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GALNT1 Products
Required fields are marked with *
My Review for All GALNT1 Products
Required fields are marked with *




