Recombinant Human GALNTL5, His-tagged
Cat.No. : | GALNTL5-88H |
Product Overview : | Recombinant Human Putative Polypeptide N-Acetylgalactosaminyltransferase-Like Protein 5/GALNTL5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (His28-Leu443) of Human GALNTL5 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 28-443 a.a. |
AA Sequence : | AHHNHVSSWQKKSQEPLSAWSPGKKVHQQIIYGSEQIPKPHVIVKRTDEDKAKSMLGTDFNHTNP ELHKELLKYGFNVIISRSLGIEREVPDTRSKMRLQKHYPARLPTASIVICFYNEECNALFQTMSS VTNLTPHYFLEEIILVDDMSKVDDLKEKLDYHLETFRGKVKIIRNKKREGLIRARLIGASHASGD VLVFLDSHCEVNRVWLEPLLHAIAKDPKMVVCPLIDVIDDRTLEYKPSPLVRGTFDWNLQFKWDN VFSYEMDGPEGSTKPIRSPAMSGGIFAIRRHYFNEIGQYDKDMDFWGRENLELSLRIWMCGGQLF IIPCSRVGHISKKQTGKPSTIISAMTHNYLRLVHVWLDEYKEQFFLRKPGLKYVTYGNIRERVEL RKRLGCKSFQWYLDNVFPELEASVNSLVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | GALNTL5 UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5 [ Homo sapiens ] |
Official Symbol | GALNTL5 |
Synonyms | GALNTL5; UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase-like 5; GALNT15, UDP N acetyl alpha D galactosamine:polypeptide N acetylgalactosaminyltransferase 15; putative polypeptide N-acetylgalactosaminyltransferase-like protein 5; galNAc-T15; pp-GaNTase 15; polypeptide GalNAc transferase 15; protein-UDP acetylgalactosaminyltransferase 15; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 15; GALNT15; |
Gene ID | 168391 |
mRNA Refseq | NM_145292 |
Protein Refseq | NP_660335 |
UniProt ID | Q7Z4T8 |
Chromosome Location | 7q36.2 |
Pathway | Metabolic pathways, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; O-glycan biosynthesis, mucin type core, organism-specific biosystem; O-glycan biosynthesis, mucin type core, conserved biosystem; O-linked glycosylation of mucins, organism-specific biosystem; |
Function | transferase activity, transferring glycosyl groups; |
◆ Recombinant Proteins | ||
GALNT15-4710H | Recombinant Human GALNT15 Protein, GST-tagged | +Inquiry |
GALNT15-1255H | Recombinant Human GALNT15 Protein, MYC/DDK-tagged | +Inquiry |
GALNT15-5304HF | Recombinant Full Length Human GALNT15 Protein, GST-tagged | +Inquiry |
GALNT15-87H | Recombinant Human GALNT15, His-tagged | +Inquiry |
GALNT15-5720H | Recombinant Human GALNT15 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GALNT15 Products
Required fields are marked with *
My Review for All GALNT15 Products
Required fields are marked with *
0
Inquiry Basket