Recombinant Human GAPDH protein, T7/His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human GAPDH protein, T7/His-tagged

Recombinant Human GAPDH protein, T7/His-tagged

GAPDH Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GAPDH-231H
Product Overview : Recombinant human GAPDH cDNA ( 2 – 335 aa, Isoform-I ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : T7/His
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMF QYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS APSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWR DGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKG ILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name : GAPDH glyceraldehyde-3-phosphate dehydrogenase [ Homo sapiens ]
Official Symbol : GAPDH
Synonyms : GAPDH; glyceraldehyde-3-phosphate dehydrogenase; GAPD; aging-associated gene 9 protein; peptidyl-cysteine S-nitrosylase GAPDH; G3PD; MGC88685;
Gene ID : 2597
mRNA Refseq : NM_001256799
Protein Refseq : NP_001243728
MIM : 138400
UniProt ID : P04406
Chromosome Location : 12p13.31
Pathway : Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate =>fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate =>
Function : NAD binding; NADP binding; glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity; glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity; oxidoreductase activity; peptidyl-cysteine S-nitrosylase activity; protein b

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.