Recombinant Human GAPDH protein, T7/His-tagged

Cat.No. : GAPDH-231H
Product Overview : Recombinant human GAPDH cDNA ( 2 – 335 aa, Isoform-I ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 2-335 a.a.
Form : 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMF QYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS APSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWR DGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKG ILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Purity : >90% by SDS-PAGE
Storage : Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name GAPDH glyceraldehyde-3-phosphate dehydrogenase [ Homo sapiens ]
Official Symbol GAPDH
Synonyms GAPDH; glyceraldehyde-3-phosphate dehydrogenase; GAPD; aging-associated gene 9 protein; peptidyl-cysteine S-nitrosylase GAPDH; G3PD; MGC88685;
Gene ID 2597
mRNA Refseq NM_001256799
Protein Refseq NP_001243728
MIM 138400
UniProt ID P04406
Chromosome Location 12p13.31
Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate =>fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate =>
Function NAD binding; NADP binding; glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity; glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity; oxidoreductase activity; peptidyl-cysteine S-nitrosylase activity; protein b

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAPDH Products

Required fields are marked with *

My Review for All GAPDH Products

Required fields are marked with *

0
cart-icon
0
compare icon