"GAPDH" Related Products

Expand
Expand
Expand

Recombinant Human GAPDH protein, T7/His-tagged

Cat.No.: GAPDH-231H
Product Overview: Recombinant human GAPDH cDNA ( 2 – 335 aa, Isoform-I ) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMF QYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS APSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWR DGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKG ILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: GAPDH glyceraldehyde-3-phosphate dehydrogenase [ Homo sapiens ]
Official Symbol: GAPDH
Synonyms: GAPDH; glyceraldehyde-3-phosphate dehydrogenase; GAPD; aging-associated gene 9 protein; peptidyl-cysteine S-nitrosylase GAPDH; G3PD; MGC88685;
Gene ID: 2597
mRNA Refseq: NM_001256799
Protein Refseq: NP_001243728
MIM: 138400
UniProt ID: P04406
Chromosome Location: 12p13.31
Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate =>fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate =>
Function: NAD binding; NADP binding; glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity; glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity; oxidoreductase activity; peptidyl-cysteine S-nitrosylase activity; protein b

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.