Recombinant Human GATA3
Cat.No. : | GATA3-28477TH |
Product Overview : | Recombinant fragment corresponding to amino acids 103-200 of Human GATA3 with a proprietary tag; Predicted MWt 36.41 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 98 amino acids |
Description : | This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia. |
Molecular Weight : | 36.410kDa |
Tissue specificity : | T-cells and endothelial cells. |
Biological activity : | useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSH |
Sequence Similarities : | Contains 2 GATA-type zinc fingers. |
Gene Name | GATA3 GATA binding protein 3 [ Homo sapiens ] |
Official Symbol | GATA3 |
Synonyms | GATA3; GATA binding protein 3; trans-acting T-cell-specific transcription factor GATA-3; HDR; |
Gene ID | 2625 |
mRNA Refseq | NM_001002295 |
Protein Refseq | NP_001002295 |
MIM | 131320 |
Uniprot ID | P23771 |
Chromosome Location | 10p15 |
Pathway | Adipogenesis, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem; |
Function | DNA binding; E-box binding; HMG box domain binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; core promoter proximal region sequence-specif; |
◆ Recombinant Proteins | ||
GATA3-2194H | Recombinant Human GATA3 Protein, His-tagged | +Inquiry |
GATA3-5436HFL | Recombinant Full Length Human GATA3 protein, Flag-tagged | +Inquiry |
GATA3-963H | Recombinant Human GATA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GATA3-2941H | Recombinant Human GATA3 protein, MYC/DDK-tagged | +Inquiry |
GATA3-02H | Recombinant Human GATA3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATA3-6011HCL | Recombinant Human GATA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GATA3 Products
Required fields are marked with *
My Review for All GATA3 Products
Required fields are marked with *