Recombinant Human GATA3

Cat.No. : GATA3-28477TH
Product Overview : Recombinant fragment corresponding to amino acids 103-200 of Human GATA3 with a proprietary tag; Predicted MWt 36.41 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia.
Molecular Weight : 36.410kDa
Tissue specificity : T-cells and endothelial cells.
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSH
Sequence Similarities : Contains 2 GATA-type zinc fingers.
Gene Name GATA3 GATA binding protein 3 [ Homo sapiens ]
Official Symbol GATA3
Synonyms GATA3; GATA binding protein 3; trans-acting T-cell-specific transcription factor GATA-3; HDR;
Gene ID 2625
mRNA Refseq NM_001002295
Protein Refseq NP_001002295
MIM 131320
Uniprot ID P23771
Chromosome Location 10p15
Pathway Adipogenesis, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem;
Function DNA binding; E-box binding; HMG box domain binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; core promoter proximal region sequence-specif;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GATA3 Products

Required fields are marked with *

My Review for All GATA3 Products

Required fields are marked with *

0
cart-icon