Recombinant Human GATA3

• Cat.No.: GATA3-28477TH
• Product Overview: Recombinant fragment corresponding to amino acids 103-200 of Human GATA3 with a proprietary tag; Predicted MWt 36.41 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 98 amino acids
• Description: This gene encodes a protein which belongs to the GATA family of transcription factors. The protein contains two GATA-type zinc fingers and is an important regulator of T-cell development and plays an important role in endothelial cell biology. Defects in this gene are the cause of hypoparathyroidism with sensorineural deafness and renal dysplasia.
• Molecular Weight: 36.410kDa
• Tissue specificity: T-cells and endothelial cells.
• Biological activity: useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LGSHHTASPWNLSPFSKTSIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDEKECLKYQVPLPDSMKLESSH
• Sequence Similarities: Contains 2 GATA-type zinc fingers.

Gene Information

• Gene Name: GATA3 GATA binding protein 3 [ Homo sapiens ]
• Official Symbol: GATA3
• Synonyms: GATA3; GATA binding protein 3; trans-acting T-cell-specific transcription factor GATA-3; HDR
• Gene ID: 2625
• mRNA Refseq: NM_001002295
• Protein Refseq: NP_001002295
• MIM: 131320
• Uniprot ID: P23771
• Chromosome Location: 10p15
• Pathway: Adipogenesis, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem
• Function: DNA binding; E-box binding; HMG box domain binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; core promoter proximal region sequence-specif