Recombinant Human GATA6

Cat.No. : GATA6-28981TH
Product Overview : Recombinant fragment corresponding to amino acids 496-595 of Human Gata6 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells GATA6 Thought to be important for regulating terminal differentiation and/or
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Expressed in heart, gut and gut-derived tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA
Sequence Similarities : Contains 2 GATA-type zinc fingers.
Gene Name GATA6 GATA binding protein 6 [ Homo sapiens ]
Official Symbol GATA6
Synonyms GATA6; GATA binding protein 6; transcription factor GATA-6;
Gene ID 2627
mRNA Refseq NM_005257
Protein Refseq NP_005248
MIM 601656
Uniprot ID Q92908
Chromosome Location 18q11-q12
Pathway Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Heart Development, organism-specific biosystem; Hemostasis, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem;
Function RNA polymerase II repressing transcription factor binding; chromatin binding; double-stranded DNA binding; metal ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GATA6 Products

Required fields are marked with *

My Review for All GATA6 Products

Required fields are marked with *

0
cart-icon