Recombinant Human GATA6
Cat.No. : | GATA6-28981TH |
Product Overview : | Recombinant fragment corresponding to amino acids 496-595 of Human Gata6 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells GATA6 Thought to be important for regulating terminal differentiation and/or |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Expressed in heart, gut and gut-derived tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA |
Sequence Similarities : | Contains 2 GATA-type zinc fingers. |
Gene Name | GATA6 GATA binding protein 6 [ Homo sapiens ] |
Official Symbol | GATA6 |
Synonyms | GATA6; GATA binding protein 6; transcription factor GATA-6; |
Gene ID | 2627 |
mRNA Refseq | NM_005257 |
Protein Refseq | NP_005248 |
MIM | 601656 |
Uniprot ID | Q92908 |
Chromosome Location | 18q11-q12 |
Pathway | Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Heart Development, organism-specific biosystem; Hemostasis, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; |
Function | RNA polymerase II repressing transcription factor binding; chromatin binding; double-stranded DNA binding; metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
GATA6-9101Z | Recombinant Zebrafish GATA6 | +Inquiry |
GATA6-28981TH | Recombinant Human GATA6 | +Inquiry |
GATA6-046H | Recombinant Human GATA6 Protein, His-tagged | +Inquiry |
GATA6-6227M | Recombinant Mouse GATA6 Protein | +Inquiry |
GATA6-3485M | Recombinant Mouse GATA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATA6-6009HCL | Recombinant Human GATA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GATA6 Products
Required fields are marked with *
My Review for All GATA6 Products
Required fields are marked with *
0
Inquiry Basket