Recombinant Human GATAD2B protein, His-tagged
| Cat.No. : | GATAD2B-2643H |
| Product Overview : | Recombinant Human GATAD2B protein(1-170 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-170 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLR |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GATAD2B GATA zinc finger domain containing 2B [ Homo sapiens ] |
| Official Symbol | GATAD2B |
| Synonyms | GATAD2B; GATA zinc finger domain containing 2B; transcriptional repressor p66-beta; P66beta; transcription repressor p66 beta component of the MeCP1 complex; p66/p68; GATA zinc finger domain-containing protein 2B; FLJ37346; KIAA1150; RP11-216N14.6; MGC138257; MGC138285; |
| Gene ID | 57459 |
| mRNA Refseq | NM_020699 |
| Protein Refseq | NP_065750 |
| UniProt ID | Q8WXI9 |
| ◆ Recombinant Proteins | ||
| GATAD2B-4758H | Recombinant Human GATAD2B Protein, GST-tagged | +Inquiry |
| GATAD2B-6230M | Recombinant Mouse GATAD2B Protein | +Inquiry |
| GATAD2B-5476HF | Recombinant Full Length Human GATAD2B Protein, GST-tagged | +Inquiry |
| GATAD2B-2643H | Recombinant Human GATAD2B protein, His-tagged | +Inquiry |
| GATAD2B-4063Z | Recombinant Zebrafish GATAD2B | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GATAD2B-6007HCL | Recombinant Human GATAD2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GATAD2B Products
Required fields are marked with *
My Review for All GATAD2B Products
Required fields are marked with *
