Recombinant Human GATAD2B protein, His-tagged

• Cat.No.: GATAD2B-2643H
• Product Overview: Recombinant Human GATAD2B protein(1-170 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-170 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: GATAD2B GATA zinc finger domain containing 2B [ Homo sapiens ]
• Official Symbol: GATAD2B
• Synonyms: GATAD2B; GATA zinc finger domain containing 2B; transcriptional repressor p66-beta; P66beta; transcription repressor p66 beta component of the MeCP1 complex; p66/p68; GATA zinc finger domain-containing protein 2B; FLJ37346; KIAA1150; RP11-216N14.6; MGC138257; MGC138285
• Gene ID: 57459
• mRNA Refseq: NM_020699
• Protein Refseq: NP_065750
• UniProt ID: Q8WXI9