Recombinant Human GATC Protein, GST-tagged

Cat.No. : GATC-4760H
Product Overview : Human GATC full-length ORF ( NP_789788.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : GATC (Glutamyl-TRNA Amidotransferase Subunit C) is a Protein Coding gene. Among its related pathways are Metabolism and tRNA Aminoacylation. GO annotations related to this gene include glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity. An important paralog of this gene is ENSG00000111780.
Molecular Mass : 41.5 kDa
AA Sequence : MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GATC glutamyl-tRNA amidotransferase subunit C [ Homo sapiens (human) ]
Official Symbol GATC
Synonyms GATC; glutamyl-tRNA amidotransferase subunit C; 15E1.2; glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial; glu-AdT subunit C; glutamyl-tRNA(Gln) amidotransferase, subunit C homolog; EC 6.3.5.-
Gene ID 283459
mRNA Refseq NM_176818
Protein Refseq NP_789788
MIM 617210
UniProt ID O43716

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GATC Products

Required fields are marked with *

My Review for All GATC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon