Recombinant Human GC Protein, His-tagged
| Cat.No. : | GC-1222H |
| Product Overview : | Recombinant Human GC Protein (19-474aa) Protein was expressed in E. coli with N-terminal His-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-474 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 55.0 kDa |
| AA Sequence : | RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | GC group-specific component (vitamin D binding protein) [ Homo sapiens ] |
| Official Symbol | GC |
| Synonyms | GC; group-specific component (vitamin D binding protein); vitamin D-binding protein; DBP; hDBP; VDBP; VDB; gc-globulin; vitamin D-binding alpha-globulin; GRD3; VDBG; DBP/GC |
| Gene ID | 2638 |
| mRNA Refseq | NM_000583 |
| Protein Refseq | NP_000574 |
| UniProt ID | P02774 |
| ◆ Recombinant Proteins | ||
| GC-6445C | Recombinant Chicken GC | +Inquiry |
| Gc-2948M | Recombinant Mouse Gc protein, His-tagged | +Inquiry |
| Gc-1828M | Recombinant Mouse Gc protein, His & GST-tagged | +Inquiry |
| GC-2079H | Recombinant Human GC Protein (Lys120-Leu474), N-His tagged | +Inquiry |
| GC-1222H | Recombinant Human GC Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| GC-524H | Native Human GC protein | +Inquiry |
| GC-29857TH | Native Human GC | +Inquiry |
| GC-198H | Native Human GC-Globulin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GC-5995HCL | Recombinant Human GC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GC Products
Required fields are marked with *
My Review for All GC Products
Required fields are marked with *



