Recombinant Human GC protein, His-tagged
Cat.No. : | GC-2947H |
Product Overview : | Recombinant Human GC protein(P02774)(19-474aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-474aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 55 kDa |
AA Sequence : | RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GC group-specific component (vitamin D binding protein) [ Homo sapiens ] |
Official Symbol | GC |
Synonyms | GC; group-specific component (vitamin D binding protein); vitamin D-binding protein; DBP; hDBP; VDBP; VDB; gc-globulin; vitamin D-binding alpha-globulin; GRD3; VDBG; DBP/GC; |
Gene ID | 2638 |
mRNA Refseq | NM_000583 |
Protein Refseq | NP_000574 |
UniProt ID | P02774 |
◆ Recombinant Proteins | ||
Gc-3169M | Recombinant Mouse Gc Protein, Myc/DDK-tagged | +Inquiry |
GC-689Z | Recombinant Zebrafish GC | +Inquiry |
GC-1254HFL | Recombinant Full Length Human GC Protein, C-Flag-tagged | +Inquiry |
GC-971H | Recombinant Human GC Protein, His (Fc)-Avi-tagged | +Inquiry |
GC-1825H | Recombinant Human GC protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
GC-29857TH | Native Human GC | +Inquiry |
GC-198H | Native Human GC-Globulin | +Inquiry |
GC-524H | Native Human GC protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GC-5995HCL | Recombinant Human GC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GC Products
Required fields are marked with *
My Review for All GC Products
Required fields are marked with *
0
Inquiry Basket