Recombinant Human GC protein, His-tagged
| Cat.No. : | GC-2947H |
| Product Overview : | Recombinant Human GC protein(P02774)(19-474aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 19-474aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 55 kDa |
| AA Sequence : | RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDAELKNIL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | GC group-specific component (vitamin D binding protein) [ Homo sapiens ] |
| Official Symbol | GC |
| Synonyms | GC; group-specific component (vitamin D binding protein); vitamin D-binding protein; DBP; hDBP; VDBP; VDB; gc-globulin; vitamin D-binding alpha-globulin; GRD3; VDBG; DBP/GC; |
| Gene ID | 2638 |
| mRNA Refseq | NM_000583 |
| Protein Refseq | NP_000574 |
| UniProt ID | P02774 |
| ◆ Recombinant Proteins | ||
| GC-5160HF | Recombinant Full Length Human GC Protein, GST-tagged | +Inquiry |
| GC-200H | Recombinant Human GC Protein, His-tagged | +Inquiry |
| Gc-1827M | Recombinant Mouse Gc protein, His-tagged | +Inquiry |
| GC-224H | Recombinant Human GC | +Inquiry |
| GC-1320H | Recombinant Human GC Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| GC-524H | Native Human GC protein | +Inquiry |
| GC-198H | Native Human GC-Globulin | +Inquiry |
| GC-29857TH | Native Human GC | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GC-5995HCL | Recombinant Human GC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GC Products
Required fields are marked with *
My Review for All GC Products
Required fields are marked with *
