Recombinant Human GCG protein, His-GST-tagged

• Cat.No.: GCG-2950H
• Product Overview: Recombinant Human GCG protein(P01275)(53-89aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 53-89aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 34.4 kDa
• AA Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: GCG glucagon [ Homo sapiens ]
• Official Symbol: GCG
• Synonyms: GCG; glucagon; glicentin related polypeptide; GLP1; GLP2; glucagon like peptide 1; glucagon like peptide 2; GRPP; glucagon-like peptide 1; glucagon-like peptide 2; glicentin-related polypeptide
• Gene ID: 2641
• mRNA Refseq: NM_002054
• Protein Refseq: NP_002045
• MIM: 138030
• UniProt ID: P01275