Recombinant Human GCGR protein, His&Myc-tagged
Cat.No. : | GCGR-2951H |
Product Overview : | Recombinant Human GCGR protein(P47871)(26-136aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 26-136aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.5 kDa |
AA Sequence : | AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GCGR glucagon receptor [ Homo sapiens ] |
Official Symbol | GCGR |
Synonyms | GCGR; glucagon receptor; GGR; GL-R; FLJ97182; MGC138246; |
Gene ID | 2642 |
mRNA Refseq | NM_000160 |
Protein Refseq | NP_000151 |
MIM | 138033 |
UniProt ID | P47871 |
◆ Recombinant Proteins | ||
GCGR-1495H | Active Recombinant Human GCGR protein, His-Avi-tagged, Biotinylated | +Inquiry |
GCGR-2488R | Recombinant Rat GCGR Protein | +Inquiry |
GCGR-0097H | Active Recombinant Human GCGR Full Length Transmembrane protein(VLPs) | +Inquiry |
GCGR-1494H | Active Recombinant Human GCGR protein, Fc-tagged | +Inquiry |
GCGR-2107H | Recombinant Human GCGR protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCGR-5989HCL | Recombinant Human GCGR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCGR Products
Required fields are marked with *
My Review for All GCGR Products
Required fields are marked with *