Recombinant Human GCGR Protein, His-tagged

Cat.No. : GCGR-001H
Product Overview : Recombinant Human GCGR Protein (125 AA) with His tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a glucagon receptor that is important in controlling blood glucose levels. Defects in this gene are a cause of non-insulin-dependent diabetes mellitus (NIDDM).
Molecular Mass : 14.9 kDa (calculated)
AA Sequence : MQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQLEHHHHHH
Endotoxin : < 1.0 EU/μg
Purity : ≥ 95%
Applications : WB, ELISA
Quality Control Test : BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
LAL to determine quantity of endotoxin.
Notes : This product is intended for research use only.
Stability : Lyophilized protein remains stable until the expiry date when stored at –80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week.
Storage : Store the lyophilized protein at –80 centigrade.
Storage Buffer : Filtered (0.4 μm) and lyophilized from solution in acetonitrile/0,1%TFA + 1% (w/v) trehalose
Reconstitution : Add 200 µL of deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
Shipping : At ambient temperature.
Gene Name GCGR glucagon receptor [ Homo sapiens (human) ]
Official Symbol GCGR
Synonyms GCGR; glucagon receptor; GGR; GL-R; glucagon receptor
Gene ID 2642
mRNA Refseq NM_000160
Protein Refseq NP_000151
MIM 138033
UniProt ID P47871

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GCGR Products

Required fields are marked with *

My Review for All GCGR Products

Required fields are marked with *

0
cart-icon