Recombinant Human GCGR Protein, His-tagged

• Cat.No.: GCGR-001H
• Product Overview: Recombinant Human GCGR Protein (125 AA) with His tag was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a glucagon receptor that is important in controlling blood glucose levels. Defects in this gene are a cause of non-insulin-dependent diabetes mellitus (NIDDM).
• Molecular Mass: 14.9 kDa (calculated)
• AA Sequence: MQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKMYSSFQLEHHHHHH
• Endotoxin: < 1.0 EU/μg
• Purity: ≥ 95%
• Applications: WB, ELISA
• Quality Control Test: BCA to determine quantity of the protein.
  SDS PAGE to determine purity of the protein.
  LAL to determine quantity of endotoxin.
• Notes: This product is intended for research use only.
• Stability: Lyophilized protein remains stable until the expiry date when stored at –80 centigrade. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80 centigrade for long term storage. Reconstituted protein can be stored at 4 centigrade for a week.
• Storage: Store the lyophilized protein at –80 centigrade.
• Storage Buffer: Filtered (0.4 μm) and lyophilized from solution in acetonitrile/0,1%TFA + 1% (w/v) trehalose
• Reconstitution: Add 200 µL of deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Filter sterilize your culture media/working solutions containing this non-sterile product before using in cell culture.
• Shipping: At ambient temperature.

Gene Information

• Gene Name: GCGR glucagon receptor [ Homo sapiens (human) ]
• Official Symbol: GCGR
• Synonyms: GCGR; glucagon receptor; GGR; GL-R; glucagon receptor
• Gene ID: 2642
• mRNA Refseq: NM_000160
• Protein Refseq: NP_000151
• MIM: 138033
• UniProt ID: P47871