Recombinant Human GDF11 protein
Cat.No. : | GDF11-01H |
Product Overview : | Recombinant Human GDF11 was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein plays a role in the development of the nervous and other organ systems, and may regulate aging. |
Form : | 20mM Tris-HCl, 200 mM NaCl, pH7.4, 2Mm DTT |
Molecular Mass : | ~13 kDa |
AA Sequence : | NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS |
Purity : | > 95% as determined by SDS-PAGE |
Storage : | Short Term Storage (1 week) at +4 centigrade, Long Term Storage(3 months) at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles. |
Concentration : | 0.1 mg/ml |
Gene Name | GDF11 growth differentiation factor 11 [ Homo sapiens ] |
Official Symbol | GDF11 |
Synonyms | GDF11; growth differentiation factor 11; growth/differentiation factor 11; BMP 11; GDF-11; bone morphogenetic protein 11; BMP11; BMP-11; |
Gene ID | 10220 |
mRNA Refseq | NM_005811 |
Protein Refseq | NP_005802 |
MIM | 603936 |
UniProt ID | O95390 |
Chromosome Location | 12q13.13 |
Function | cytokine activity; growth factor activity; |
◆ Recombinant Proteins | ||
Gdf11-108M | Active Recombinant Mouse Gdf11 protein | +Inquiry |
GDF11-103H | Recombinant Active Human GDF11 Protein, His-tagged(C-ter) | +Inquiry |
GDF11-1078H | Active Recombinant Human GDF11 | +Inquiry |
GDF11-6284M | Recombinant Mouse GDF11 Protein | +Inquiry |
GDF11-07H | Active Recombinant Human GDF11 Protein (Asn299-Ser407), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDF11 Products
Required fields are marked with *
My Review for All GDF11 Products
Required fields are marked with *
0
Inquiry Basket