Recombinant Human GDF11 protein

Cat.No. : GDF11-01H
Product Overview : Recombinant Human GDF11 was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein plays a role in the development of the nervous and other organ systems, and may regulate aging.
Form : 20mM Tris-HCl, 200 mM NaCl, pH7.4, 2Mm DTT
Molecular Mass : ~13 kDa
AA Sequence : NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Purity : > 95% as determined by SDS-PAGE
Storage : Short Term Storage (1 week) at +4 centigrade, Long Term Storage(3 months) at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.1 mg/ml
Gene Name GDF11 growth differentiation factor 11 [ Homo sapiens ]
Official Symbol GDF11
Synonyms GDF11; growth differentiation factor 11; growth/differentiation factor 11; BMP 11; GDF-11; bone morphogenetic protein 11; BMP11; BMP-11;
Gene ID 10220
mRNA Refseq NM_005811
Protein Refseq NP_005802
MIM 603936
UniProt ID O95390
Chromosome Location 12q13.13
Function cytokine activity; growth factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDF11 Products

Required fields are marked with *

My Review for All GDF11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon