Recombinant Human GDF11 protein
| Cat.No. : | GDF11-01H |
| Product Overview : | Recombinant Human GDF11 was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein plays a role in the development of the nervous and other organ systems, and may regulate aging. |
| Form : | 20mM Tris-HCl, 200 mM NaCl, pH7.4, 2Mm DTT |
| Molecular Mass : | ~13 kDa |
| AA Sequence : | NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS |
| Purity : | > 95% as determined by SDS-PAGE |
| Storage : | Short Term Storage (1 week) at +4 centigrade, Long Term Storage(3 months) at -20 centigrade to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.1 mg/ml |
| Gene Name | GDF11 growth differentiation factor 11 [ Homo sapiens ] |
| Official Symbol | GDF11 |
| Synonyms | GDF11; growth differentiation factor 11; growth/differentiation factor 11; BMP 11; GDF-11; bone morphogenetic protein 11; BMP11; BMP-11; |
| Gene ID | 10220 |
| mRNA Refseq | NM_005811 |
| Protein Refseq | NP_005802 |
| MIM | 603936 |
| UniProt ID | O95390 |
| Chromosome Location | 12q13.13 |
| Function | cytokine activity; growth factor activity; |
| ◆ Recombinant Proteins | ||
| Gdf11-282M | Recombinant Mouse Gdf11 Protein, His-tagged | +Inquiry |
| GDF11-12223Z | Recombinant Zebrafish GDF11 | +Inquiry |
| GDF11-103H | Recombinant Active Human GDF11 Protein, His-tagged(C-ter) | +Inquiry |
| GDF11-105H | Active Recombinant Human/Mouse/Rat GDF11 Protein | +Inquiry |
| GDF11-4820H | Recombinant Human GDF11 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDF11 Products
Required fields are marked with *
My Review for All GDF11 Products
Required fields are marked with *
