Recombinant Human GDF15 Protein, His tagged
Cat.No. : | GDF15-338H |
Product Overview : | Recombinant Human GDF15 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress. |
Molecular Mass : | The protein has a calculated MW of 13 kDa. |
AA Sequence : | MHHHHHHARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.3 mg/mL by BCA |
Storage Buffer : | Sterile 20 mM PB, 100 mM NaCl, pH6.4, 20% Glycerol |
Gene Name | GDF15 growth differentiation factor 15 [ Homo sapiens ] |
Official Symbol | GDF15 |
Synonyms | GDF15; growth differentiation factor 15; growth/differentiation factor 15; MIC 1; MIC1; NAG 1; PDF; PLAB; prostate differentiation factor; PTGFB; NRG-1; PTGF-beta; placental TGF-beta; NSAID-activated gene 1 protein; NSAID-regulated gene 1 protein; macrophage inhibitory cytokine 1; placental bone morphogenetic protein; NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1; MIC-1; NAG-1; GDF-15; |
Gene ID | 9518 |
mRNA Refseq | NM_004864 |
Protein Refseq | NP_004855 |
MIM | 605312 |
UniProt ID | Q99988 |
◆ Recombinant Proteins | ||
GDF15-338H | Recombinant Human GDF15 Protein, His tagged | +Inquiry |
GDF15-20H | Recombinant Human GDF15 protein(Ala197-Ile308), His-tagged | +Inquiry |
GDF15-204H | Recombinant Human GDF15 protein, hFc-tagged | +Inquiry |
GDF15-337H | Recombinant Human Growth Differentiation Factor 15 | +Inquiry |
GDF15-1724H | Recombinant Human GDF15 protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Native Proteins | ||
GDF15-27680TH | Active Native Human GDF15 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF15-2705HCL | Recombinant Human GDF15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDF15 Products
Required fields are marked with *
My Review for All GDF15 Products
Required fields are marked with *
0
Inquiry Basket