Recombinant Human GDF15 Protein, His tagged

Cat.No. : GDF15-338H
Product Overview : Recombinant Human GDF15 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The protein is expressed in a broad range of cell types, acts as a pleiotropic cytokine and is involved in the stress response program of cells after cellular injury. Increased protein levels are associated with disease states such as tissue hypoxia, inflammation, acute injury and oxidative stress.
Molecular Mass : The protein has a calculated MW of 13 kDa.
AA Sequence : MHHHHHHARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1.3 mg/mL by BCA
Storage Buffer : Sterile 20 mM PB, 100 mM NaCl, pH6.4, 20% Glycerol
Gene Name GDF15 growth differentiation factor 15 [ Homo sapiens ]
Official Symbol GDF15
Synonyms GDF15; growth differentiation factor 15; growth/differentiation factor 15; MIC 1; MIC1; NAG 1; PDF; PLAB; prostate differentiation factor; PTGFB; NRG-1; PTGF-beta; placental TGF-beta; NSAID-activated gene 1 protein; NSAID-regulated gene 1 protein; macrophage inhibitory cytokine 1; placental bone morphogenetic protein; NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1; MIC-1; NAG-1; GDF-15;
Gene ID 9518
mRNA Refseq NM_004864
Protein Refseq NP_004855
MIM 605312
UniProt ID Q99988

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDF15 Products

Required fields are marked with *

My Review for All GDF15 Products

Required fields are marked with *

0
cart-icon