Recombinant Human GDF15 protein, His-tagged

Cat.No. : GDF15-285H
Product Overview : Recombinant Human GDF15 protein is produced by E. coli expression system. This protein is fused with a His tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : Ala195-Ile308
Form : PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
Molecular Mass : 16 kDa
AA Sequence : ARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
Purity : > 95 %
Applications : Positive Control; Immunogen; SDS-PAGE; WB.
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Reconstitution : Reconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Gene Name GDF15 growth differentiation factor 15 [ Homo sapiens ]
Official Symbol GDF15
Synonyms GDF15; MIC 1; MIC1; NAG 1; PDF; PLAB; PTGFB; NRG-1; PTGF-beta; placental TGF-beta; MIC-1; NAG-1; GDF-15;
Gene ID 9518
mRNA Refseq NM_004864
Protein Refseq NP_004855
MIM 605312
UniProt ID Q99988

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDF15 Products

Required fields are marked with *

My Review for All GDF15 Products

Required fields are marked with *

0
cart-icon