Recombinant Human GDI2 Protein (1-445 aa), His-tagged
Cat.No. : | GDI2-2332H |
Product Overview : | Recombinant Human GDI2 Protein (1-445 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-445 aa |
Description : | Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from th, and the subsequent binding of GTP to th. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 52.7 kDa |
AA Sequence : | MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | GDI2 GDP dissociation inhibitor 2 [ Homo sapiens ] |
Official Symbol | GDI2 |
Synonyms | GDI2; GDP dissociation inhibitor 2; rab GDP dissociation; RABGDIB; GDI-2; rab GDI beta; FLJ16452; FLJ37352; |
Gene ID | 2665 |
mRNA Refseq | NM_001115156 |
Protein Refseq | NP_001108628 |
MIM | 600767 |
UniProt ID | P50395 |
◆ Recombinant Proteins | ||
GDI2-28229TH | Recombinant Human GDI2 | +Inquiry |
GDI2-2603H | Recombinant Human GDI2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GDI2-2954H | Recombinant Human GDI2 protein, His-SUMO-tagged | +Inquiry |
GDI2-5151H | Recombinant Human GDI2 protein, GST-tagged | +Inquiry |
GDI2-5246HF | Recombinant Full Length Human GDI2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDI2-5964HCL | Recombinant Human GDI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDI2 Products
Required fields are marked with *
My Review for All GDI2 Products
Required fields are marked with *
0
Inquiry Basket