Recombinant Human GDI2 Protein, GST-tagged
| Cat.No. : | GDI2-4833H |
| Product Overview : | Human GDI2 full-length ORF ( AAH05145.1, 1 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI2 is ubiquitously expressed. The GDI2 gene contains many repetitive elements indicating that it may be prone to inversion/deletion rearrangements. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq |
| Molecular Mass : | 74.69 kDa |
| AA Sequence : | MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMERGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLGAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GDI2 GDP dissociation inhibitor 2 [ Homo sapiens ] |
| Official Symbol | GDI2 |
| Synonyms | GDI2; GDP dissociation inhibitor 2; rab GDP dissociation inhibitor beta; rab GDP dissociation; RABGDIB; GDI-2; rab GDI beta; rab GDP-dissociation inhibitor, beta; guanosine diphosphate dissociation inhibitor 2; FLJ16452; FLJ37352; |
| Gene ID | 2665 |
| mRNA Refseq | NM_001115156 |
| Protein Refseq | NP_001108628 |
| MIM | 600767 |
| UniProt ID | P50395 |
| ◆ Recombinant Proteins | ||
| GDI2-10054Z | Recombinant Zebrafish GDI2 | +Inquiry |
| GDI2-2603H | Recombinant Human GDI2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GDI2-2332H | Recombinant Human GDI2 Protein (1-445 aa), His-tagged | +Inquiry |
| GDI2-5151H | Recombinant Human GDI2 protein, GST-tagged | +Inquiry |
| GDI2-4833H | Recombinant Human GDI2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GDI2-5964HCL | Recombinant Human GDI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDI2 Products
Required fields are marked with *
My Review for All GDI2 Products
Required fields are marked with *
