Recombinant Human GDNF Protein, GST-tagged
Cat.No. : | GDNF-4835H |
Product Overview : | Human GDNF full-length ORF ( NP_000505.1, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a highly conserved neurotrophic factor. The recombinant form of this protein was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. The encoded protein is processed to a mature secreted form that exists as a homodimer. The mature form of the protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. In addition to the transcript encoding GDNF, two additional alternative transcripts encoding distinct proteins, referred to as astrocyte-derived trophic factors, have also been described. Mutations in this gene may be associated with Hirschsprung disease. [provided by RefSeq |
Molecular Mass : | 50.1 kDa |
AA Sequence : | MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GDNF glial cell derived neurotrophic factor [ Homo sapiens ] |
Official Symbol | GDNF |
Synonyms | GDNF; glial cell derived neurotrophic factor; glial cell line-derived neurotrophic factor; astrocyte derived trophic factor; ATF1; ATF2; glial cell line derived neurotrophic factor; glial derived neurotrophic factor; HFB1 GDNF; ATF; astrocyte-derived trophic factor; HSCR3; HFB1-GDNF; |
Gene ID | 2668 |
mRNA Refseq | NM_000514 |
Protein Refseq | NP_000505 |
MIM | 600837 |
UniProt ID | P39905 |
◆ Recombinant Proteins | ||
GDNF-6293M | Recombinant Mouse GDNF Protein | +Inquiry |
GDNF-4414H | Recombinant Human GDNF Protein, His (Fc)-Avi-tagged | +Inquiry |
GDNF-5248HF | Recombinant Full Length Human GDNF Protein, GST-tagged | +Inquiry |
GDNF-985H | Active Recombinant Human GDNF | +Inquiry |
Gdnf-779M | Recombinant Mouse Gdnf protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDNF-400RCL | Recombinant Rat GDNF cell lysate | +Inquiry |
GDNF-1549HCL | Recombinant Human GDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDNF Products
Required fields are marked with *
My Review for All GDNF Products
Required fields are marked with *