Recombinant Human GDNF Protein, His-tagged

Cat.No. : GDNF-01H
Product Overview : Recombinant human GDNF (109-211aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Availability June 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 109-211aa
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The recombinant form of this protein, a highly conserved neurotrophic factor, was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. This protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. Mutations in this gene may be associated with Hirschsprung disease and Tourette syndrome. This gene encodes multiple protein isoforms that may undergo similar proteolytic processing.
Form : Liquid
Molecular Mass : 12.8kDa (113aa)
AA Sequence : RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol.
Gene Name GDNF glial cell derived neurotrophic factor [ Homo sapiens (human) ]
Official Symbol GDNF
Synonyms GDNF; glial cell derived neurotrophic factor; ATF; ATF1; ATF2; HSCR3; HFB1-GDNF; glial cell line-derived neurotrophic factor; astrocyte-derived trophic factor
Gene ID https://www.ncbi.nlm.nih.gov/gene/2668
mRNA Refseq https://www.ncbi.nlm.nih.gov/nuccore/NM_000514.4
Protein Refseq https://www.ncbi.nlm.nih.gov/protein/NP_000505.1
MIM https://omim.org/entry/600837
UniProt ID https://www.uniprot.org/uniprotkb/P39905/entry

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDNF Products

Required fields are marked with *

My Review for All GDNF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon