Species : |
Human |
Source : |
Insect Cells |
Tag : |
His |
Protein Length : |
109-211aa |
Description : |
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. The recombinant form of this protein, a highly conserved neurotrophic factor, was shown to promote the survival and differentiation of dopaminergic neurons in culture, and was able to prevent apoptosis of motor neurons induced by axotomy. This protein is a ligand for the product of the RET (rearranged during transfection) protooncogene. Mutations in this gene may be associated with Hirschsprung disease and Tourette syndrome. This gene encodes multiple protein isoforms that may undergo similar proteolytic processing. |
Form : |
Liquid |
Molecular Mass : |
12.8kDa (113aa) |
AA Sequence : |
RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
Endotoxin : |
< 1 EU/μg of protein (determined by LAL method) |
Purity : |
> 90% by SDS-PAGE |
Applications : |
SDS-PAGE |
Storage : |
Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : |
0.25 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : |
In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol. |