Recombinant Human GFOD1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GFOD1-1816H |
Product Overview : | GFOD1 MS Standard C13 and N15-labeled recombinant protein (NP_061861) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | GFOD1 (Glucose-Fructose Oxidoreductase Domain Containing 1) is a Protein Coding gene. Diseases associated with GFOD1 include Attention Deficit-Hyperactivity Disorder. Gene Ontology (GO) annotations related to this gene include oxidoreductase activity. An important paralog of this gene is GFOD2. |
Molecular Mass : | 43 kDa |
AA Sequence : | MLPGVGVFGTSLTARVIIPLLKDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCINLPPPLTRQIAVKTLGIGKNVICDRTATPLDAFRMTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYVGEPLVCEVQVHGGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIKGIRQITSDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQDATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GFOD1 glucose-fructose oxidoreductase domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | GFOD1 |
Synonyms | GFOD1; glucose-fructose oxidoreductase domain containing 1; C6orf114, chromosome 6 open reading frame 114; glucose-fructose oxidoreductase domain-containing protein 1; ADG 90; FLJ20330; ADG-90; C6orf114; FLJ30569; MGC70653; RP11-501I19.1; |
Gene ID | 54438 |
mRNA Refseq | NM_018988 |
Protein Refseq | NP_061861 |
UniProt ID | Q9NXC2 |
◆ Recombinant Proteins | ||
GFOD1-001H | Recombinant Human GFOD1 Protein, Myc/DDK-tagged | +Inquiry |
GFOD1-1857H | Recombinant Human GFOD1 Protein, His-tagged | +Inquiry |
GFOD1-1834R | Recombinant Rhesus monkey GFOD1 Protein, His-tagged | +Inquiry |
GFOD1-6313M | Recombinant Mouse GFOD1 Protein | +Inquiry |
GFOD1-91H | Recombinant Human GFOD1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GFOD1-696HCL | Recombinant Human GFOD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GFOD1 Products
Required fields are marked with *
My Review for All GFOD1 Products
Required fields are marked with *
0
Inquiry Basket