Recombinant Human GFRAL protein, His&Myc-tagged
Cat.No. : | GFRAL-4564H |
Product Overview : | Recombinant Human GFRAL protein(Q6UXV0)(19-351aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 19-351aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.8 kDa |
AA Sequence : | SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GFRAL GDNF family receptor alpha like [ Homo sapiens ] |
Official Symbol | GFRAL |
Synonyms | GFRAL; GDNF family receptor alpha like; C6orf144, chromosome 6 open reading frame 144; GDNF family receptor alpha-like; bA360D14.1; GRAL; UNQ9356; IVFI9356; C6orf144; |
Gene ID | 389400 |
mRNA Refseq | NM_207410 |
Protein Refseq | NP_997293 |
UniProt ID | Q6UXV0 |
◆ Recombinant Proteins | ||
GFRAL-5733H | Recombinant Human GFRAL protein, hFc-tagged | +Inquiry |
GFRAL-3065H | Recombinant Human GFRAL protein, His-tagged | +Inquiry |
GFRAL-001H | Recombinant Human GFRAL Protein, 19-351, N-Fc tagged | +Inquiry |
GFRAL-1929H | Recombinant Human GFRAL Protein (19-351 aa), His-SUMO-tagged | +Inquiry |
GFRAL-4564H | Recombinant Human GFRAL protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFRAL Products
Required fields are marked with *
My Review for All GFRAL Products
Required fields are marked with *