Recombinant Human GGT1 protein, His-tagged
| Cat.No. : | GGT1-7855H |
| Product Overview : | Recombinant Human GGT1 protein(381-470 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 381-470 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GGT1 gamma-glutamyltransferase 1 [ Homo sapiens ] |
| Official Symbol | GGT1 |
| Synonyms | GGT1; gamma-glutamyltransferase 1; GGT; gamma-glutamyltranspeptidase 1; CD224; D22S672; D22S732; glutamyl transpeptidase; glutathione hydrolase 1; gamma-glutamyl transpeptidase; GTG; GGT 1; MGC96892; MGC96904; MGC96963; |
| Gene ID | 2678 |
| mRNA Refseq | NM_001032364 |
| Protein Refseq | NP_001027536 |
| MIM | 612346 |
| UniProt ID | P19440 |
| ◆ Recombinant Proteins | ||
| GGT1-2523R | Recombinant Rat GGT1 Protein | +Inquiry |
| GGT1-2179R | Recombinant Rat GGT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GGT1-196HF | Recombinant Full Length Human GGT1 Protein | +Inquiry |
| GGT1-4876H | Recombinant Human GGT1 Protein, GST-tagged | +Inquiry |
| GGT1-7855H | Recombinant Human GGT1 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
| GGT1-8131H | Native Human Liver Gamma Glutamyl Transpeptidase | +Inquiry |
| GGT1-8130H | Native Human Liver Gamma-Glutamyltransferase | +Inquiry |
| GGT1-5353H | Native Human Gamma-Glutamyltransferase 1 | +Inquiry |
| GGT1-371P | Native Porcine Gamma-Glutamyltransferase 1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GGT1-1344RCL | Recombinant Rat GGT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GGT1 Products
Required fields are marked with *
My Review for All GGT1 Products
Required fields are marked with *
