Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GHRHR

Cat.No. : GHRHR-29025TH
Product Overview : Recombinant fragment of Human GHRHR (amino acids 23-132) with N terminal proprietary tag; Predicted MWt 37.73 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a receptor for growth hormone-releasing hormone. Binding of this hormone to the receptor leads to synthesis and release of growth hormone. Mutations in this gene have been associated with isolated growth hormone deficiency (IGHD), also known as Dwarfism of Sindh, a disorder characterized by short stature.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Pituitary gland.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : HMHPECDFITQLREDESACLQAAEEMPNTTLGCPATWDGL LCWPTAGSGEWVTLPCPDFFSHFSSESGAVKRDCTITGWS EPFPPYPVACPVPLELLAEEESYFSTVKII
Sequence Similarities : Belongs to the G-protein coupled receptor 2 family.
Gene Name : GHRHR growth hormone releasing hormone receptor [ Homo sapiens ]
Official Symbol : GHRHR
Synonyms : GHRHR; growth hormone releasing hormone receptor; growth hormone-releasing hormone receptor;
Gene ID : 2692
mRNA Refseq : NM_000823
Protein Refseq : NP_000814
MIM : 139191
Uniprot ID : Q02643
Chromosome Location : 7p14
Pathway : Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem;
Function : G-protein coupled receptor activity; growth factor binding; growth hormone-releasing hormone receptor activity; growth hormone-releasing hormone receptor activity; peptide hormone binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends