Recombinant Human GIMAP2 protein, GST-tagged
| Cat.No. : | GIMAP2-13255H | 
| Product Overview : | Recombinant Human GIMAP2 protein(1-258 aa), fused with N-terminal GST tag, was expressed in E.coli. | 
| Availability | October 31, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | GST | 
| Protein Length : | 1-258 aa | 
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). | 
| AASequence : | MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAE | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. | 
| Gene Name | GIMAP2 GTPase, IMAP family member 2 [ Homo sapiens ] | 
| Official Symbol | GIMAP2 | 
| Synonyms | GIMAP2; GTPase, IMAP family member 2; GTPase IMAP family member 2; DKFZp586D0824; HIMAP2; IMAP2; immunity associated protein 2; immunity-associated protein 2; MGC24275; | 
| Gene ID | 26157 | 
| mRNA Refseq | NM_015660 | 
| Protein Refseq | NP_056475 | 
| MIM | 608085 | 
| UniProt ID | Q9UG22 | 
| ◆ Recombinant Proteins | ||
| RFL10238HF | Recombinant Full Length Human Gtpase Imap Family Member 2(Gimap2) Protein, His-Tagged | +Inquiry | 
| GIMAP2-3419H | Recombinant Human GIMAP2 protein, His-tagged | +Inquiry | 
| GIMAP2-13255H | Recombinant Human GIMAP2 protein, GST-tagged | +Inquiry | 
| GIMAP2-4898H | Recombinant Human GIMAP2 Protein, GST-tagged | +Inquiry | 
| GIMAP2-1669R | Recombinant Rhesus Macaque GIMAP2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GIMAP2-705HCL | Recombinant Human GIMAP2 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIMAP2 Products
Required fields are marked with *
My Review for All GIMAP2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            