Recombinant Human GIMAP2 Protein, GST-tagged
| Cat.No. : | GIMAP2-4898H |
| Product Overview : | Human GIMAP2 full-length ORF ( NP_056475.1, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq |
| Molecular Mass : | 64.4 kDa |
| AA Sequence : | MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLFLRLIILWLCILHSMCNLFCCLLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GIMAP2 GTPase, IMAP family member 2 [ Homo sapiens ] |
| Official Symbol | GIMAP2 |
| Synonyms | GIMAP2; GTPase, IMAP family member 2; GTPase IMAP family member 2; DKFZp586D0824; HIMAP2; IMAP2; immunity associated protein 2; immunity-associated protein 2; MGC24275; |
| Gene ID | 26157 |
| mRNA Refseq | NM_015660 |
| Protein Refseq | NP_056475 |
| MIM | 608085 |
| UniProt ID | Q9UG22 |
| ◆ Recombinant Proteins | ||
| GIMAP2-3419H | Recombinant Human GIMAP2 protein, His-tagged | +Inquiry |
| GIMAP2-1669R | Recombinant Rhesus Macaque GIMAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GIMAP2-1849R | Recombinant Rhesus monkey GIMAP2 Protein, His-tagged | +Inquiry |
| GIMAP2-13255H | Recombinant Human GIMAP2 protein, GST-tagged | +Inquiry |
| GIMAP2-5256HF | Recombinant Full Length Human GIMAP2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GIMAP2-705HCL | Recombinant Human GIMAP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIMAP2 Products
Required fields are marked with *
My Review for All GIMAP2 Products
Required fields are marked with *
