Recombinant Human GIMAP2 protein, His-tagged
Cat.No. : | GIMAP2-3419H |
Product Overview : | Recombinant Human GIMAP2 protein(1-258 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-258 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKTCSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTSQDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRICAFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFKQSLIKYMETQRSYTALAE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GIMAP2 GTPase, IMAP family member 2 [ Homo sapiens ] |
Official Symbol | GIMAP2 |
Synonyms | GIMAP2; GTPase, IMAP family member 2; GTPase IMAP family member 2; DKFZp586D0824; HIMAP2; IMAP2; immunity associated protein 2; immunity-associated protein 2; MGC24275; |
Gene ID | 26157 |
mRNA Refseq | NM_015660 |
Protein Refseq | NP_056475 |
MIM | 608085 |
UniProt ID | Q9UG22 |
◆ Recombinant Proteins | ||
GIMAP2-1849R | Recombinant Rhesus monkey GIMAP2 Protein, His-tagged | +Inquiry |
GIMAP2-1669R | Recombinant Rhesus Macaque GIMAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GIMAP2-4898H | Recombinant Human GIMAP2 Protein, GST-tagged | +Inquiry |
RFL10238HF | Recombinant Full Length Human Gtpase Imap Family Member 2(Gimap2) Protein, His-Tagged | +Inquiry |
GIMAP2-5256HF | Recombinant Full Length Human GIMAP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GIMAP2-705HCL | Recombinant Human GIMAP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GIMAP2 Products
Required fields are marked with *
My Review for All GIMAP2 Products
Required fields are marked with *
0
Inquiry Basket