Recombinant Human GIT1 protein, GST-tagged
Cat.No. : | GIT1-301196H |
Product Overview : | Recombinant Human GIT1 (470-640 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu470-Pro640 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
AA Sequence : | LRQPPGPVPTPPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELEDDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | GIT1 G protein-coupled receptor kinase interacting ArfGAP 1 [ Homo sapiens ] |
Official Symbol | GIT1 |
Synonyms | GIT1; G protein-coupled receptor kinase interacting ArfGAP 1; G protein coupled receptor kinase interactor 1; ARF GTPase-activating protein GIT1; CAT1; CAT-1; ARF GAP GIT1; GRK-interacting protein 1; G protein-coupled receptor kinase interactor 1; G protein-coupled receptor kinase-interactor 1; cool-associated and tyrosine-phosphorylated protein 1; |
Gene ID | 28964 |
mRNA Refseq | NM_001085454 |
Protein Refseq | NP_001078923 |
MIM | 608434 |
UniProt ID | Q9Y2X7 |
◆ Recombinant Proteins | ||
GIT1-3983H | Recombinant Human GIT1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GIT1-13268H | Recombinant Human GIT1, His-tagged | +Inquiry |
GIT1-5869C | Recombinant Chicken GIT1 | +Inquiry |
GIT1-2200R | Recombinant Rat GIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GIT1-301196H | Recombinant Human GIT1 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
GIT1-001H | Recombinant Human GIT1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GIT1-5926HCL | Recombinant Human GIT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIT1 Products
Required fields are marked with *
My Review for All GIT1 Products
Required fields are marked with *
0
Inquiry Basket