Recombinant Human GJA5 protein, GST-tagged
| Cat.No. : | GJA5-375H |
| Product Overview : | Recombinant Human GJA5 protein(233-341 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 233-341 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | KIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GJA5 gap junction protein, alpha 5, 40kDa [ Homo sapiens ] |
| Official Symbol | GJA5 |
| Synonyms | GJA5; gap junction protein, alpha 5, 40kDa; gap junction protein, alpha 5, 40kD (connexin 40) , gap junction protein, alpha 5, 40kDa (connexin 40); gap junction alpha-5 protein; connexin 40; CX40; connexin-40; ATFB11; MGC11185; |
| Gene ID | 2702 |
| mRNA Refseq | NM_005266 |
| Protein Refseq | NP_005257 |
| MIM | 121013 |
| UniProt ID | P36382 |
| ◆ Recombinant Proteins | ||
| GJA5-375H | Recombinant Human GJA5 protein, GST-tagged | +Inquiry |
| RFL10783GF | Recombinant Full Length Chicken Gap Junction Alpha-5 Protein(Gja5) Protein, His-Tagged | +Inquiry |
| GJA5-13275H | Recombinant Human GJA5, GST-tagged | +Inquiry |
| RFL15691BF | Recombinant Full Length Bovine Gap Junction Alpha-5 Protein(Gja5) Protein, His-Tagged | +Inquiry |
| GJA5-2204R | Recombinant Rat GJA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GJA5-5921HCL | Recombinant Human GJA5 293 Cell Lysate | +Inquiry |
| GJA5-5920HCL | Recombinant Human GJA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GJA5 Products
Required fields are marked with *
My Review for All GJA5 Products
Required fields are marked with *
