Recombinant Human GLA therapeutic protein(Agalsidase alfa)
Cat.No. : | GLA-P027H |
Product Overview : | Recombinant human alpha-galactosidase A. The mature protein is composed of 2 subunits of 398 residues. Protein is glycosylated and produced by CHO cells. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | Non |
Protein Length : | 398 Aa |
Description : | This gene encodes a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties. The expression product is the active ingredient of Fabrazyme and Replagal. |
Molecular Mass : | 45.4 kDa |
AA Sequence : | LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDS EGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCY CDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIKSILD WTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKD VIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQ LLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENTMQMSLKDLL |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | GLA; GALA; Agalsidase alfa |
Gene Name | GLA galactosidase, alpha [ Homo sapiens ] |
Official Symbol | GLA |
Synonyms | GLA; galactosidase, alpha; alpha-galactosidase A; GALA; melibiase; alpha-gal A; agalsidase alfa; alpha-D-galactosidase A; alpha-D-galactoside galactohydrolase 1; |
Gene ID | 2717 |
mRNA Refseq | NM_000169 |
Protein Refseq | NP_000160 |
MIM | 300644 |
UniProt ID | P06280 |
Chromosome Location | Xq21.3-q22 |
Pathway | Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; Glycosphingolipid biosynthesis - globo series, organism-specific biosystem; Glycosphingolipid biosynthesis - globo series, conserved biosystem; Glycosphingolipid metabolism, organism-specific biosystem; |
Function | alpha-galactosidase activity; alpha-galactosidase activity; alpha-galactosidase activity; catalytic activity; cation binding; galactoside binding; hydrolase activity; hydrolase activity, hydrolyzing O-glycosyl compounds; protein binding; protein homodimerization activity; raffinose alpha-galactosidase activity; receptor binding; |
◆ Recombinant Proteins | ||
GLA-5307HF | Recombinant Full Length Human GLA Protein, GST-tagged | +Inquiry |
GLA-2340H | Recombinant Human GLA Protein (Trp81-Leu429), His tagged | +Inquiry |
GLA-174H | Recombinant Human GLA Protein, His-tagged | +Inquiry |
GLA-2963H | Recombinant Human GLA protein, His-tagged | +Inquiry |
GLA-1609Z | Recombinant Zebrafish GLA | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLA-1521MCL | Recombinant Mouse GLA cell lysate | +Inquiry |
GLA-2173HCL | Recombinant Human GLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLA Products
Required fields are marked with *
My Review for All GLA Products
Required fields are marked with *
0
Inquiry Basket