Recombinant Human GLA therapeutic protein(Agalsidase alfa)

Cat.No. : GLA-P027H
Product Overview : Recombinant human alpha-galactosidase A. The mature protein is composed of 2 subunits of 398 residues. Protein is glycosylated and produced by CHO cells.
Availability June 10, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : Non
Protein Length : 398 Aa
Description : This gene encodes a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties. The expression product is the active ingredient of Fabrazyme and Replagal.
Molecular Mass : 45.4 kDa
AA Sequence : LDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFMEMAELMVSEGWKDAGYEYLCIDDCWMAPQRDS EGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCY CDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIKSILD WTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKD VIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWAVAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQ LLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENTMQMSLKDLL
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Alias : GLA; GALA; Agalsidase alfa
Gene Name GLA galactosidase, alpha [ Homo sapiens ]
Official Symbol GLA
Synonyms GLA; galactosidase, alpha; alpha-galactosidase A; GALA; melibiase; alpha-gal A; agalsidase alfa; alpha-D-galactosidase A; alpha-D-galactoside galactohydrolase 1;
Gene ID 2717
mRNA Refseq NM_000169
Protein Refseq NP_000160
MIM 300644
UniProt ID P06280
Chromosome Location Xq21.3-q22
Pathway Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Glycerolipid metabolism, organism-specific biosystem; Glycerolipid metabolism, conserved biosystem; Glycosphingolipid biosynthesis - globo series, organism-specific biosystem; Glycosphingolipid biosynthesis - globo series, conserved biosystem; Glycosphingolipid metabolism, organism-specific biosystem;
Function alpha-galactosidase activity; alpha-galactosidase activity; alpha-galactosidase activity; catalytic activity; cation binding; galactoside binding; hydrolase activity; hydrolase activity, hydrolyzing O-glycosyl compounds; protein binding; protein homodimerization activity; raffinose alpha-galactosidase activity; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLA Products

Required fields are marked with *

My Review for All GLA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon