Recombinant Human GLI2 protein, His-SUMO-tagged

Cat.No. : GLI2-2965H
Product Overview : Recombinant Human GLI2 protein(P10070)(412-641aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 412-641aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 42.5 kDa
AA Sequence : EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name GLI2 GLI family zinc finger 2 [ Homo sapiens ]
Official Symbol GLI2
Synonyms GLI2; GLI family zinc finger 2; GLI Kruppel family member GLI2 , glioma associated oncogene family zinc finger 2; zinc finger protein GLI2; HPE9; tax helper protein 1; tax helper protein 2; tax responsive element 2 holding protein; THP1; THP2; oncogene GLI2; GLI-Kruppel family member GLI2; tax-responsive element-2 holding protein; glioma-associated oncogene family zinc finger 2; tax-responsive element-25-bp sequence binding protein;
Gene ID 2736
mRNA Refseq NM_005270
Protein Refseq NP_005261
MIM 165230
UniProt ID P10070

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLI2 Products

Required fields are marked with *

My Review for All GLI2 Products

Required fields are marked with *

0
cart-icon