Recombinant Human GLI2 protein, His-SUMO-tagged
Cat.No. : | GLI2-2965H |
Product Overview : | Recombinant Human GLI2 protein(P10070)(412-641aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 412-641aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.5 kDa |
AA Sequence : | EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | GLI2 GLI family zinc finger 2 [ Homo sapiens ] |
Official Symbol | GLI2 |
Synonyms | GLI2; GLI family zinc finger 2; GLI Kruppel family member GLI2 , glioma associated oncogene family zinc finger 2; zinc finger protein GLI2; HPE9; tax helper protein 1; tax helper protein 2; tax responsive element 2 holding protein; THP1; THP2; oncogene GLI2; GLI-Kruppel family member GLI2; tax-responsive element-2 holding protein; glioma-associated oncogene family zinc finger 2; tax-responsive element-25-bp sequence binding protein; |
Gene ID | 2736 |
mRNA Refseq | NM_005270 |
Protein Refseq | NP_005261 |
MIM | 165230 |
UniProt ID | P10070 |
◆ Recombinant Proteins | ||
GLI2-133H | Recombinant Human GLI2 protein, His/sumo-tagged | +Inquiry |
GLI2-6402M | Recombinant Mouse GLI2 Protein | +Inquiry |
GLI2-2965H | Recombinant Human GLI2 protein, His-SUMO-tagged | +Inquiry |
GLI2-2038H | Recombinant Human GLI2 Protein (412-641 aa), His-tagged | +Inquiry |
GLI2-4674C | Recombinant Chicken GLI2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLI2 Products
Required fields are marked with *
My Review for All GLI2 Products
Required fields are marked with *