Recombinant Human GLI2 protein, His-tagged

Cat.No. : GLI2-3852H
Product Overview : Recombinant Human GLI2 protein(601-795 aa), fused to His tag, was expressed in E. coli.
Availability November 17, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 601-795 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : NDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGSGSILENFSGSGGGGPAGLLPNPRLSELSASE
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name GLI2 GLI family zinc finger 2 [ Homo sapiens ]
Official Symbol GLI2
Synonyms GLI2; GLI family zinc finger 2; GLI Kruppel family member GLI2 , glioma associated oncogene family zinc finger 2; zinc finger protein GLI2; HPE9; tax helper protein 1; tax helper protein 2; tax responsive element 2 holding protein; THP1; THP2; oncogene GLI2; GLI-Kruppel family member GLI2; tax-responsive element-2 holding protein; glioma-associated oncogene family zinc finger 2; tax-responsive element-25-bp sequence binding protein;
Gene ID 2736
mRNA Refseq NM_005270
Protein Refseq NP_005261
MIM 165230
UniProt ID P10070

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLI2 Products

Required fields are marked with *

My Review for All GLI2 Products

Required fields are marked with *

0
cart-icon
0
compare icon