Recombinant Human GLI2 protein, His-tagged
| Cat.No. : | GLI2-3852H |
| Product Overview : | Recombinant Human GLI2 protein(601-795 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 601-795 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | NDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTESSGLCQSSPGAQSSCSSEPSPLGSAPNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLRKHMTTMHRFEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGSGSILENFSGSGGGGPAGLLPNPRLSELSASE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | GLI2 GLI family zinc finger 2 [ Homo sapiens ] |
| Official Symbol | GLI2 |
| Synonyms | GLI2; GLI family zinc finger 2; GLI Kruppel family member GLI2 , glioma associated oncogene family zinc finger 2; zinc finger protein GLI2; HPE9; tax helper protein 1; tax helper protein 2; tax responsive element 2 holding protein; THP1; THP2; oncogene GLI2; GLI-Kruppel family member GLI2; tax-responsive element-2 holding protein; glioma-associated oncogene family zinc finger 2; tax-responsive element-25-bp sequence binding protein; |
| Gene ID | 2736 |
| mRNA Refseq | NM_005270 |
| Protein Refseq | NP_005261 |
| MIM | 165230 |
| UniProt ID | P10070 |
| ◆ Recombinant Proteins | ||
| GLI2-3852H | Recombinant Human GLI2 protein, His-tagged | +Inquiry |
| GLI2-5018H | Recombinant Human GLI2 protein, His-tagged | +Inquiry |
| GLI2-4673C | Recombinant Chicken GLI2 | +Inquiry |
| GLI2-2965H | Recombinant Human GLI2 protein, His-SUMO-tagged | +Inquiry |
| GLI2-2038H | Recombinant Human GLI2 Protein (412-641 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLI2 Products
Required fields are marked with *
My Review for All GLI2 Products
Required fields are marked with *
