"GLI3" Related Products

Expand
Expand

Recombinant Human GLI3 Protein, GST-tagged

Cat.No. : GLI3-4956H
Product Overview : Human GLI3 partial ORF ( NP_000159, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes a protein which belongs to the C2H2-type zinc finger proteins subclass of the Gli family. They are characterized as DNA-binding transcription factors and are mediators of Sonic hedgehog (Shh) signaling. The protein encoded by this gene localizes in the cytoplasm and activates patched Drosophila homolog (PTCH) gene expression. It is also thought to play a role during embryogenesis. Mutations in this gene have been associated with several diseases, including Greig cephalopolysyndactyly syndrome, Pallister-Hall syndrome, preaxial polydactyly type IV, and postaxial polydactyly types A1 and B. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 37.84 kDa
AA Sequence : MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : GLI3 GLI family zinc finger 3 [ Homo sapiens ]
Official Symbol : GLI3
Synonyms : GLI3; GLI family zinc finger 3; GCPS, GLI Kruppel family member GLI3, glioma associated oncogene family zinc finger 3, Greig cephalopolysyndactyly syndrome, PHS; transcriptional activator GLI3; ACLS; DNA binding protein; oncogene GLI3; PAP A; PAPA; PAPA1; PAPB; PPDIV; zinc finger protein GLI3; GLI-Kruppel family member GLI3; glioma-associated oncogene family zinc finger 3; PHS; GCPS; PAP-A; GLI3FL; GLI3-190;
Gene ID : 2737
mRNA Refseq : NM_000168
Protein Refseq : NP_000159
MIM : 165240
UniProt ID : P10071

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.