Recombinant Human GLIPR Protein (22-232 aa), His-tagged

Cat.No. : GLIPR-526H
Product Overview : Recombinant Human GLIPR Protein (22-232 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 22-232 aa
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 28.1 kDa
AA Sequence : ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNR
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name GLIPR1 GLI pathogenesis related 1 [ Homo sapiens (human) ]
Official Symbol GLIPR
Synonyms GLIPR; RTVP1; CRISP7;
Gene ID 11010
mRNA Refseq NM_006851
Protein Refseq NP_006842
UniProt ID P48060

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLIPR Products

Required fields are marked with *

My Review for All GLIPR Products

Required fields are marked with *

0
cart-icon
0
compare icon