Recombinant Human GLIPR1 Protein, GST-tagged
Cat.No. : | GLIPR1-4959H |
Product Overview : | Human GLIPR1 partial ORF ( NP_006842, 23 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq |
Molecular Mass : | 34.21 kDa |
AA Sequence : | NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLIPR1 GLI pathogenesis-related 1 [ Homo sapiens ] |
Official Symbol | GLIPR1 |
Synonyms | GLIPR1; GLI pathogenesis-related 1; GLI pathogenesis related 1 (glioma); glioma pathogenesis-related protein 1; GliPR; RTVP1; gliPR 1; protein RTVP-1; GLI pathogenesis-related 1 (glioma); testes-specific vespid and pathogenesis protein 1; related to testis-specific, vespid, and pathogenesis proteins 1; GLIPR; CRISP7; |
Gene ID | 11010 |
mRNA Refseq | NM_006851 |
Protein Refseq | NP_006842 |
MIM | 602692 |
UniProt ID | P48060 |
◆ Recombinant Proteins | ||
GLIPR1-1867R | Recombinant Rhesus monkey GLIPR1 Protein, His-tagged | +Inquiry |
GLIPR1-3190H | Recombinant Human GLIPR1 protein(Met1-Arg232), His-tagged | +Inquiry |
GLIPR1-4959H | Recombinant Human GLIPR1 Protein, GST-tagged | +Inquiry |
GLIPR1-157M | Recombinant Mouse Glipr1, His tagged | +Inquiry |
RFL36506HF | Recombinant Full Length Human Glioma Pathogenesis-Related Protein 1(Glipr1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLIPR1-807MCL | Recombinant Mouse GLIPR1 cell lysate | +Inquiry |
GLIPR1-2392HCL | Recombinant Human GLIPR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLIPR1 Products
Required fields are marked with *
My Review for All GLIPR1 Products
Required fields are marked with *