Recombinant Human GLIPR1 Protein, GST-tagged

Cat.No. : GLIPR1-4959H
Product Overview : Human GLIPR1 partial ORF ( NP_006842, 23 a.a. - 99 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein with similarity to both the pathogenesis-related protein (PR) superfamily and the cysteine-rich secretory protein (CRISP) family. Increased expression of this gene is associated with myelomocytic differentiation in macrophage and decreased expression of this gene through gene methylation is associated with prostate cancer. The protein has proapoptotic activities in prostate and bladder cancer cells. This gene is a member of a cluster on chromosome 12 containing two other similar genes. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. [provided by RefSeq
Molecular Mass : 34.21 kDa
AA Sequence : NILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGEN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLIPR1 GLI pathogenesis-related 1 [ Homo sapiens ]
Official Symbol GLIPR1
Synonyms GLIPR1; GLI pathogenesis-related 1; GLI pathogenesis related 1 (glioma); glioma pathogenesis-related protein 1; GliPR; RTVP1; gliPR 1; protein RTVP-1; GLI pathogenesis-related 1 (glioma); testes-specific vespid and pathogenesis protein 1; related to testis-specific, vespid, and pathogenesis proteins 1; GLIPR; CRISP7;
Gene ID 11010
mRNA Refseq NM_006851
Protein Refseq NP_006842
MIM 602692
UniProt ID P48060

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLIPR1 Products

Required fields are marked with *

My Review for All GLIPR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon