Recombinant Full Length Human Glioma Pathogenesis-Related Protein 1(Glipr1) Protein, His-Tagged
Cat.No. : | RFL36506HF |
Product Overview : | Recombinant Full Length Human Glioma pathogenesis-related protein 1(GLIPR1) Protein (P48060) (22-266aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (22-266) |
Form : | Lyophilized powder |
AA Sequence : | ANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNT RLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQV VWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKC LDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIVNSVILILSVIITILVQHKYPN LVLLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GLIPR1 |
Synonyms | CRISP 7; CRISP7; GLI pathogenesis related 1; GLI pathogenesis-related 1 (glioma); Glioma pathogenesis related protein 1; Glioma pathogenesis-related protein 1; GLIP1_HUMAN; GliPR 1; GLIPR; GLIPR1; Protein RTVP-1; RELATED TO TESTIS SPECIFIC; VESPID; AND PA |
UniProt ID | P48060 |
◆ Recombinant Proteins | ||
RFL36506HF | Recombinant Full Length Human Glioma Pathogenesis-Related Protein 1(Glipr1) Protein, His-Tagged | +Inquiry |
GLIPR1-2966H | Recombinant Human GLIPR1 protein, His-tagged | +Inquiry |
GLIPR1-4959H | Recombinant Human GLIPR1 Protein, GST-tagged | +Inquiry |
GLIPR1-1687R | Recombinant Rhesus Macaque GLIPR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLIPR1-1867R | Recombinant Rhesus monkey GLIPR1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLIPR1-2392HCL | Recombinant Human GLIPR1 cell lysate | +Inquiry |
GLIPR1-807MCL | Recombinant Mouse GLIPR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLIPR1 Products
Required fields are marked with *
My Review for All GLIPR1 Products
Required fields are marked with *
0
Inquiry Basket