Recombinant Human GLIPR1L1 Protein, His-tagged
| Cat.No. : | GLIPR1L1-993H |
| Product Overview : | Recombinant Human GLIPR1L1 Protein(Q6UWM5)(23-221 aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 23-221 aa |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 23 kDa |
| AASequence : | SKIPSITDPHFIDNCIEAHNEWRGKVNPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCSRVCGHYTQLVWANSFYVGCAVAMCPNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVKNLCRTPQLIIPNQNPFLKPTG |
| Storage : | Store at -20°C to -80°C. |
| Concentration : | 0.1-1.0 mg/ml |
| Gene Name | GLIPR1L1 GLI pathogenesis-related 1 like 1 [ Homo sapiens ] |
| Official Symbol | GLIPR1L1 |
| Synonyms | GLIPR1L1; GLI pathogenesis-related 1 like 1; GLIPR1-like protein 1; MGC26856; PRO7434; ALKN2972; |
| Gene ID | 256710 |
| mRNA Refseq | NM_152779 |
| Protein Refseq | NP_689992 |
| MIM | 610395 |
| UniProt ID | Q6UWM5 |
| ◆ Recombinant Proteins | ||
| GLIPR1L1-5330HF | Recombinant Full Length Human GLIPR1L1 Protein, GST-tagged | +Inquiry |
| GLIPR1L1-992H | Recombinant Human GLIPR1L1 | +Inquiry |
| GLIPR1L1-3040H | Recombinant Human GLIPR1L1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GLIPR1L1-993H | Recombinant Human GLIPR1L1 Protein, His-tagged | +Inquiry |
| GLIPR1L1-4960H | Recombinant Human GLIPR1L1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GLIPR1L1-711HCL | Recombinant Human GLIPR1L1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLIPR1L1 Products
Required fields are marked with *
My Review for All GLIPR1L1 Products
Required fields are marked with *
Recently Viewed
