Recombinant Human GLIPR1L2 Protein, GST-tagged
Cat.No. : | GLIPR1L2-4961H |
Product Overview : | Human GLIPR1L2 full-length ORF ( NP_689649.1, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cysteine-rich secretory protein, antigen 5, and pathogenesis-related 1 superfamily. Members of this family have roles in a variety of processes, including cancer and immune defense. This gene is located in a cluster with two related genes on chromosome 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012] |
Molecular Mass : | 55.4 kDa |
AA Sequence : | MEAARPFAREWRAQSLPLAVGGVLKLRLCELWLLLLGSSLNARFLPDEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTASIAIRSWHAEKKMYNFENGSCSGDCSNYIQLVWDHSYKVGCAVTPCSKIGHIIHAAIFICNYAPGGTLTRRPYEPGIFCTRCGRRDKCTDFLCSKIKKINMKKMHNGLDKKNKRLNTSFLWSC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLIPR1L2 GLI pathogenesis-related 1 like 2 [ Homo sapiens ] |
Official Symbol | GLIPR1L2 |
Synonyms | GLIPR1L2; GLI pathogenesis-related 1 like 2; GLIPR1-like protein 2; MGC39497; |
Gene ID | 144321 |
mRNA Refseq | NM_152436 |
Protein Refseq | NP_689649 |
MIM | 610394 |
UniProt ID | Q4G1C9 |
◆ Recombinant Proteins | ||
GLIPR1L2-6406M | Recombinant Mouse GLIPR1L2 Protein | +Inquiry |
GLIPR1L2-5331HF | Recombinant Full Length Human GLIPR1L2 Protein, GST-tagged | +Inquiry |
GLIPR1L2-4961H | Recombinant Human GLIPR1L2 Protein, GST-tagged | +Inquiry |
RFL22807HF | Recombinant Full Length Human Glipr1-Like Protein 2(Glipr1L2) Protein, His-Tagged | +Inquiry |
GLIPR1L2-13300H | Recombinant Human GLIPR1L2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLIPR1L2-5903HCL | Recombinant Human GLIPR1L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLIPR1L2 Products
Required fields are marked with *
My Review for All GLIPR1L2 Products
Required fields are marked with *
0
Inquiry Basket