Recombinant Human GLIPR1L2 Protein, GST-tagged

Cat.No. : GLIPR1L2-4961H
Product Overview : Human GLIPR1L2 full-length ORF ( NP_689649.1, 1 a.a. - 253 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the cysteine-rich secretory protein, antigen 5, and pathogenesis-related 1 superfamily. Members of this family have roles in a variety of processes, including cancer and immune defense. This gene is located in a cluster with two related genes on chromosome 12. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]
Molecular Mass : 55.4 kDa
AA Sequence : MEAARPFAREWRAQSLPLAVGGVLKLRLCELWLLLLGSSLNARFLPDEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTASIAIRSWHAEKKMYNFENGSCSGDCSNYIQLVWDHSYKVGCAVTPCSKIGHIIHAAIFICNYAPGGTLTRRPYEPGIFCTRCGRRDKCTDFLCSKIKKINMKKMHNGLDKKNKRLNTSFLWSC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLIPR1L2 GLI pathogenesis-related 1 like 2 [ Homo sapiens ]
Official Symbol GLIPR1L2
Synonyms GLIPR1L2; GLI pathogenesis-related 1 like 2; GLIPR1-like protein 2; MGC39497;
Gene ID 144321
mRNA Refseq NM_152436
Protein Refseq NP_689649
MIM 610394
UniProt ID Q4G1C9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLIPR1L2 Products

Required fields are marked with *

My Review for All GLIPR1L2 Products

Required fields are marked with *

0
cart-icon