Recombinant Human GLO1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: GLO1-4020H
• Product Overview: GLO1 MS Standard C13 and N15-labeled recombinant protein (NP_006699) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.
• Molecular Mass: 20.8 kDa
• AA Sequence: MAEPQPPSGGLTDEAALSYCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: GLO1 glyoxalase I [ Homo sapiens (human) ]
• Official Symbol: GLO1
• Synonyms: GLO1; glyoxalase I; lactoylglutathione lyase; GLOD1; glyoxalase domain containing 1; glx I; aldoketomutase; methylglyoxalase; ketone-aldehyde mutase; lactoyl glutathione lyase; S-D-lactoylglutathione methylglyoxal lyase; GLYI
• Gene ID: 2739
• mRNA Refseq: NM_006708
• Protein Refseq: NP_006699
• MIM: 138750
• UniProt ID: Q04760