Recombinant Human GLO1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GLO1-4020H
Product Overview : GLO1 MS Standard C13 and N15-labeled recombinant protein (NP_006699) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The enzyme encoded by this gene is responsible for the catalysis and formation of S-lactoyl-glutathione from methylglyoxal condensation and reduced glutatione. Glyoxalase I is linked to HLA and is localized to 6p21.3-p21.1, between HLA and the centromere.
Molecular Mass : 20.8 kDa
AA Sequence : MAEPQPPSGGLTDEAALSYCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GLO1 glyoxalase I [ Homo sapiens (human) ]
Official Symbol GLO1
Synonyms GLO1; glyoxalase I; lactoylglutathione lyase; GLOD1; glyoxalase domain containing 1; glx I; aldoketomutase; methylglyoxalase; ketone-aldehyde mutase; lactoyl glutathione lyase; S-D-lactoylglutathione methylglyoxal lyase; GLYI;
Gene ID 2739
mRNA Refseq NM_006708
Protein Refseq NP_006699
MIM 138750
UniProt ID Q04760

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLO1 Products

Required fields are marked with *

My Review for All GLO1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon