Recombinant Human GLOD4
Cat.No. : | GLOD4-27651TH |
Product Overview : | Recombinant full length Human GLOD4 expressed in Saccharomyces cerevisiae; amino acids 1-298, 298 amino acids, MWt 33.2 kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Protein Length : | 1-298 a.a. |
Description : | GLOD4, also known glyoxalase domain-containing protein 4, is an enzyme that belongs to the glyoxalase system. |
Tissue specificity : | Expressed in heart, brain, liver, kidney, pancreas and placenta. Not expressed in skeletal muscle and lung. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEG CKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVG DYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFE TEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWC NLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVD HAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSL DTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGS KLLDDAMSADKSDEWFAKHNKPKASG |
Sequence Similarities : | Belongs to the glyoxalase I family. |
Full Length : | Full L. |
Gene Name | GLOD4 glyoxalase domain containing 4 [ Homo sapiens ] |
Official Symbol | GLOD4 |
Synonyms | GLOD4; glyoxalase domain containing 4; C17orf25, chromosome 17 open reading frame 25; glyoxalase domain-containing protein 4; CGI 150; HC71; |
Gene ID | 51031 |
mRNA Refseq | NM_016080 |
Protein Refseq | NP_057164 |
Uniprot ID | Q9HC38 |
Chromosome Location | 17p13.3 |
◆ Recombinant Proteins | ||
GLOD4-2220R | Recombinant Rat GLOD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLOD4-5342HF | Recombinant Full Length Human GLOD4 Protein, GST-tagged | +Inquiry |
GLOD4-6932H | Recombinant Human GLOD4 protein, His-tagged | +Inquiry |
GLOD4-6412M | Recombinant Mouse GLOD4 Protein | +Inquiry |
GLOD4-1870R | Recombinant Rhesus monkey GLOD4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLOD4-212HCL | Recombinant Human GLOD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLOD4 Products
Required fields are marked with *
My Review for All GLOD4 Products
Required fields are marked with *