Recombinant Full Length Human GLOD4 Protein, GST-tagged
Cat.No. : | GLOD4-5342HF |
Product Overview : | Human GLOD4 full-length ORF ( AAH15848.1, 1 a.a. - 298 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 298 amino acids |
Description : | GLOD4 (Glyoxalase Domain Containing 4) is a Protein Coding gene. Diseases associated with GLOD4 include Hepatocellular Carcinoma. |
Molecular Mass : | 59.6 kDa |
AA Sequence : | MAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKIDPEGSKLLDDAMAADKSDEWFAKHNKPKASG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLOD4 glyoxalase domain containing 4 [ Homo sapiens ] |
Official Symbol | GLOD4 |
Synonyms | GLOD4; glyoxalase domain containing 4; C17orf25, chromosome 17 open reading frame 25; glyoxalase domain-containing protein 4; CGI 150; HC71; CGI-150; C17orf25; |
Gene ID | 51031 |
mRNA Refseq | NM_016080 |
Protein Refseq | NP_057164 |
UniProt ID | Q9HC38 |
◆ Recombinant Proteins | ||
GLOD4-27651TH | Recombinant Human GLOD4 | +Inquiry |
GLOD4-2220R | Recombinant Rat GLOD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLOD4-1870R | Recombinant Rhesus monkey GLOD4 Protein, His-tagged | +Inquiry |
GLOD4-1690R | Recombinant Rhesus Macaque GLOD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLOD4-6932H | Recombinant Human GLOD4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLOD4-212HCL | Recombinant Human GLOD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLOD4 Products
Required fields are marked with *
My Review for All GLOD4 Products
Required fields are marked with *