Recombinant Human GLOD4 protein, GST-tagged
Cat.No. : | GLOD4-13305H |
Product Overview : | Recombinant Human GLOD4 protein(1-298 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | July 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-298 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | MAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | GLOD4 glyoxalase domain containing 4 [ Homo sapiens ] |
Official Symbol | GLOD4 |
Synonyms | GLOD4; glyoxalase domain containing 4; C17orf25, chromosome 17 open reading frame 25; glyoxalase domain-containing protein 4; CGI 150; HC71; CGI-150; C17orf25; |
Gene ID | 51031 |
mRNA Refseq | NM_016080 |
Protein Refseq | NP_057164 |
UniProt ID | Q9HC38 |
◆ Recombinant Proteins | ||
GLOD4-27652TH | Recombinant Human GLOD4, His-tagged | +Inquiry |
GLOD4-1332Z | Recombinant Zebrafish GLOD4 | +Inquiry |
GLOD4-2564R | Recombinant Rat GLOD4 Protein | +Inquiry |
GLOD4-5457C | Recombinant Chicken GLOD4 | +Inquiry |
GLOD4-1870R | Recombinant Rhesus monkey GLOD4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLOD4-212HCL | Recombinant Human GLOD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLOD4 Products
Required fields are marked with *
My Review for All GLOD4 Products
Required fields are marked with *